Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4097040..4097838 Replicon chromosome
Accession NZ_CP104509
Organism Escherichia coli strain E2

Toxin (Protein)


Gene name yeeV Uniprot ID U9XMP3
Locus tag N5O74_RS20700 Protein ID WP_000854735.1
Coordinates 4097461..4097838 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A067H947
Locus tag N5O74_RS20695 Protein ID WP_001285415.1
Coordinates 4097040..4097414 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5O74_RS20660 (4092971) 4092971..4093651 + 681 WP_001282919.1 WYL domain-containing protein -
N5O74_RS20665 (4093799) 4093799..4094476 + 678 WP_075855334.1 hypothetical protein -
N5O74_RS20670 (4094482) 4094482..4094715 + 234 WP_001278287.1 DUF905 family protein -
N5O74_RS20675 (4094805) 4094805..4095623 + 819 WP_001175148.1 DUF932 domain-containing protein -
N5O74_RS20680 (4095705) 4095705..4096184 + 480 WP_000844100.1 antirestriction protein -
N5O74_RS20685 (4096200) 4096200..4096676 + 477 WP_001366855.1 RadC family protein -
N5O74_RS20690 (4096739) 4096739..4096960 + 222 WP_000692309.1 DUF987 domain-containing protein -
N5O74_RS20695 (4097040) 4097040..4097414 + 375 WP_001285415.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
N5O74_RS20700 (4097461) 4097461..4097838 + 378 WP_000854735.1 TA system toxin CbtA family protein Toxin
N5O74_RS20705 (4097835) 4097835..4098323 + 489 WP_000761677.1 DUF5983 family protein -
N5O74_RS20710 (4098335) 4098335..4098532 + 198 WP_000839291.1 DUF957 domain-containing protein -
N5O74_RS20715 (4098617) 4098617..4099483 + 867 WP_001280433.1 DUF4942 domain-containing protein -
N5O74_RS20720 (4099555) 4099555..4099818 + 264 WP_001143297.1 type II toxin-antitoxin system ParD family antitoxin -
N5O74_RS20725 (4099815) 4099815..4100141 + 327 WP_000779483.1 type II toxin-antitoxin system RelE/ParE family toxin -
N5O74_RS20730 (4100605) 4100605..4101870 + 1266 WP_111997674.1 integrase arm-type DNA-binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 4073139..4104299 31160


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14061.07 Da        Isoelectric Point: 8.2904

>T258200 WP_000854735.1 NZ_CP104509:4097461-4097838 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13663.32 Da        Isoelectric Point: 5.8640

>AT258200 WP_001285415.1 NZ_CP104509:4097040-4097414 [Escherichia coli]
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9XMP3

Antitoxin

Source ID Structure
AlphaFold DB A0A067H947

References