Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4097040..4097838 | Replicon | chromosome |
| Accession | NZ_CP104509 | ||
| Organism | Escherichia coli strain E2 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | U9XMP3 |
| Locus tag | N5O74_RS20700 | Protein ID | WP_000854735.1 |
| Coordinates | 4097461..4097838 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A067H947 |
| Locus tag | N5O74_RS20695 | Protein ID | WP_001285415.1 |
| Coordinates | 4097040..4097414 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O74_RS20660 (4092971) | 4092971..4093651 | + | 681 | WP_001282919.1 | WYL domain-containing protein | - |
| N5O74_RS20665 (4093799) | 4093799..4094476 | + | 678 | WP_075855334.1 | hypothetical protein | - |
| N5O74_RS20670 (4094482) | 4094482..4094715 | + | 234 | WP_001278287.1 | DUF905 family protein | - |
| N5O74_RS20675 (4094805) | 4094805..4095623 | + | 819 | WP_001175148.1 | DUF932 domain-containing protein | - |
| N5O74_RS20680 (4095705) | 4095705..4096184 | + | 480 | WP_000844100.1 | antirestriction protein | - |
| N5O74_RS20685 (4096200) | 4096200..4096676 | + | 477 | WP_001366855.1 | RadC family protein | - |
| N5O74_RS20690 (4096739) | 4096739..4096960 | + | 222 | WP_000692309.1 | DUF987 domain-containing protein | - |
| N5O74_RS20695 (4097040) | 4097040..4097414 | + | 375 | WP_001285415.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N5O74_RS20700 (4097461) | 4097461..4097838 | + | 378 | WP_000854735.1 | TA system toxin CbtA family protein | Toxin |
| N5O74_RS20705 (4097835) | 4097835..4098323 | + | 489 | WP_000761677.1 | DUF5983 family protein | - |
| N5O74_RS20710 (4098335) | 4098335..4098532 | + | 198 | WP_000839291.1 | DUF957 domain-containing protein | - |
| N5O74_RS20715 (4098617) | 4098617..4099483 | + | 867 | WP_001280433.1 | DUF4942 domain-containing protein | - |
| N5O74_RS20720 (4099555) | 4099555..4099818 | + | 264 | WP_001143297.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| N5O74_RS20725 (4099815) | 4099815..4100141 | + | 327 | WP_000779483.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| N5O74_RS20730 (4100605) | 4100605..4101870 | + | 1266 | WP_111997674.1 | integrase arm-type DNA-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 4073139..4104299 | 31160 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14061.07 Da Isoelectric Point: 8.2904
>T258200 WP_000854735.1 NZ_CP104509:4097461-4097838 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13663.32 Da Isoelectric Point: 5.8640
>AT258200 WP_001285415.1 NZ_CP104509:4097040-4097414 [Escherichia coli]
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | U9XMP3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A067H947 |