Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1902022..1902820 Replicon chromosome
Accession NZ_CP104509
Organism Escherichia coli strain E2

Toxin (Protein)


Gene name yeeV Uniprot ID A0A3L4GA68
Locus tag N5O74_RS09615 Protein ID WP_000854898.1
Coordinates 1902443..1902820 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag N5O74_RS09610 Protein ID WP_063082308.1
Coordinates 1902022..1902396 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5O74_RS09570 (1897530) 1897530..1897988 + 459 WP_063082307.1 hypothetical protein -
N5O74_RS09575 (1898114) 1898114..1898653 + 540 WP_001104026.1 DUF4339 domain-containing protein -
N5O74_RS09580 (1898923) 1898923..1899336 + 414 WP_000789536.1 hypothetical protein -
N5O74_RS09585 (1899475) 1899475..1899653 - 179 Protein_1863 hypothetical protein -
N5O74_RS09590 (1899747) 1899747..1900565 + 819 WP_001234635.1 DUF932 domain-containing protein -
N5O74_RS09595 (1900657) 1900657..1901142 + 486 WP_032180519.1 antirestriction protein -
N5O74_RS09600 (1901158) 1901158..1901634 + 477 WP_001186768.1 RadC family protein -
N5O74_RS09605 (1901721) 1901721..1901942 + 222 WP_000692352.1 DUF987 domain-containing protein -
N5O74_RS09610 (1902022) 1902022..1902396 + 375 WP_063082308.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
N5O74_RS09615 (1902443) 1902443..1902820 + 378 WP_000854898.1 TA system toxin CbtA family protein Toxin
N5O74_RS09620 (1902817) 1902817..1903305 + 489 WP_000761668.1 DUF5983 family protein -
N5O74_RS09625 (1903317) 1903317..1903514 + 198 WP_000839285.1 DUF957 domain-containing protein -
N5O74_RS09630 (1903611) 1903611..1904453 + 843 WP_072650511.1 DUF4942 domain-containing protein -
N5O74_RS09640 (1904924) 1904924..1905862 + 939 WP_000351317.1 glyoxylate/hydroxypyruvate reductase GhrA -
N5O74_RS09645 (1905917) 1905917..1906654 + 738 WP_000283667.1 zinc-binding phosphatase -
N5O74_RS09650 (1906678) 1906678..1907232 + 555 WP_001001921.1 molecular chaperone YcdY -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14050.07 Da        Isoelectric Point: 8.5190

>T258190 WP_000854898.1 NZ_CP104509:1902443-1902820 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWKTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITLGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13665.49 Da        Isoelectric Point: 6.4653

>AT258190 WP_063082308.1 NZ_CP104509:1902022-1902396 [Escherichia coli]
VSDTLPRTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTGG
ELNPRHQHTATLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3L4GA68

Antitoxin

Source ID Structure

References