Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/MqsA(antitoxin) |
| Location | 450212..450864 | Replicon | chromosome |
| Accession | NZ_CP104497 | ||
| Organism | Ralstonia pseudosolanacearum strain Gj707 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A454TTN3 |
| Locus tag | NQS38_RS20040 | Protein ID | WP_038962847.1 |
| Coordinates | 450212..450556 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NQS38_RS20045 | Protein ID | WP_020425351.1 |
| Coordinates | 450553..450864 (+) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQS38_RS20025 (NQS38_20025) | 445908..447071 | - | 1164 | WP_011003438.1 | 2-methylcitrate synthase | - |
| NQS38_RS20030 (NQS38_20030) | 447123..448019 | - | 897 | WP_020425352.1 | methylisocitrate lyase | - |
| NQS38_RS20035 (NQS38_20035) | 448212..450161 | + | 1950 | WP_118888105.1 | propionate catabolism operon regulatory protein PrpR | - |
| NQS38_RS20040 (NQS38_20040) | 450212..450556 | + | 345 | WP_038962847.1 | hypothetical protein | Toxin |
| NQS38_RS20045 (NQS38_20045) | 450553..450864 | + | 312 | WP_020425351.1 | transcriptional regulator | Antitoxin |
| NQS38_RS20050 (NQS38_20050) | 451004..451813 | - | 810 | WP_043885575.1 | DUF2242 domain-containing protein | - |
| NQS38_RS20055 (NQS38_20055) | 453100..454896 | + | 1797 | WP_118912045.1 | 3'-5' exonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 450212..489226 | 39014 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13227.94 Da Isoelectric Point: 8.4489
>T258129 WP_038962847.1 NZ_CP104497:450212-450556 [Ralstonia pseudosolanacearum]
MDATFIELPPFQRLREHYLSDDEYRALQQELLARPDAGDVIKGTGGLRKLRFSDKRRGKGKRGGLRVIDYHWDGGGQFWM
FVVYDKGEADDLSSDERKVLARLLEQEVKARSER
MDATFIELPPFQRLREHYLSDDEYRALQQELLARPDAGDVIKGTGGLRKLRFSDKRRGKGKRGGLRVIDYHWDGGGQFWM
FVVYDKGEADDLSSDERKVLARLLEQEVKARSER
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|