Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3445897..3446695 Replicon chromosome
Accession NZ_CP104472
Organism Escherichia coli strain UC4224

Toxin (Protein)


Gene name yeeV Uniprot ID A0A1X1M0U2
Locus tag N4S17_RS16685 Protein ID WP_000854919.1
Coordinates 3446318..3446695 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A2G4AEZ5
Locus tag N4S17_RS16680 Protein ID WP_001285608.1
Coordinates 3445897..3446271 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4S17_RS16640 (3441621) 3441621..3442301 + 681 WP_001282921.1 WYL domain-containing protein -
N4S17_RS16645 (3442449) 3442449..3443126 + 678 WP_001097301.1 hypothetical protein -
N4S17_RS16650 (3443132) 3443132..3443365 + 234 WP_001278293.1 DUF905 family protein -
N4S17_RS16655 (3443455) 3443455..3444273 + 819 WP_001175165.1 DUF932 domain-containing protein -
N4S17_RS16660 (3444299) 3444299..3444439 - 141 WP_000997937.1 hypothetical protein -
N4S17_RS16665 (3444539) 3444539..3445018 + 480 WP_000706980.1 antirestriction protein -
N4S17_RS16670 (3445033) 3445033..3445509 + 477 WP_021544587.1 RadC family protein -
N4S17_RS16675 (3445596) 3445596..3445817 + 222 WP_000692350.1 DUF987 domain-containing protein -
N4S17_RS16680 (3445897) 3445897..3446271 + 375 WP_001285608.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
N4S17_RS16685 (3446318) 3446318..3446695 + 378 WP_000854919.1 TA system toxin CbtA family protein Toxin
N4S17_RS16690 (3446692) 3446692..3447180 + 489 WP_000777664.1 DUF5983 family protein -
N4S17_RS16695 (3447200) 3447200..3447397 + 198 WP_001327226.1 DUF957 domain-containing protein -
N4S17_RS16700 (3447482) 3447482..3447625 + 144 Protein_3258 hypothetical protein -
N4S17_RS16705 (3448090) 3448090..3449355 + 1266 WP_001218329.1 integrase arm-type DNA-binding domain-containing protein -
N4S17_RS16710 (3449556) 3449556..3451025 - 1470 WP_028985242.1 serine/threonine-protein kinase -
N4S17_RS16715 (3451022) 3451022..3451564 - 543 WP_001115385.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fimB / fimE / fimA / fimI / fimC 3414182..3477985 63803


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14037.97 Da        Isoelectric Point: 7.9086

>T258005 WP_000854919.1 NZ_CP104472:3446318-3446695 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITLGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13610.37 Da        Isoelectric Point: 5.5051

>AT258005 WP_001285608.1 NZ_CP104472:3445897-3446271 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPAITS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1X1M0U2

Antitoxin

Source ID Structure
AlphaFold DB A0A2G4AEZ5

References