Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2044729..2045561 | Replicon | chromosome |
| Accession | NZ_CP104472 | ||
| Organism | Escherichia coli strain UC4224 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A2A2C6E0 |
| Locus tag | N4S17_RS09945 | Protein ID | WP_000854716.1 |
| Coordinates | 2044729..2045103 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | N4S17_RS09950 | Protein ID | WP_135278903.1 |
| Coordinates | 2045193..2045561 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4S17_RS09915 (2040377) | 2040377..2042218 | + | 1842 | WP_000437371.1 | RNA polymerase sigma factor RpoD | - |
| N4S17_RS09920 (2042296) | 2042296..2042802 | - | 507 | WP_000228937.1 | G/U mismatch-specific DNA glycosylase | - |
| N4S17_RS09930 (2043102) | 2043102..2043947 | - | 846 | WP_001280505.1 | DUF4942 domain-containing protein | - |
| N4S17_RS09935 (2044032) | 2044032..2044229 | - | 198 | WP_000839249.1 | DUF957 domain-containing protein | - |
| N4S17_RS09940 (2044241) | 2044241..2044732 | - | 492 | WP_000976843.1 | DUF5983 family protein | - |
| N4S17_RS09945 (2044729) | 2044729..2045103 | - | 375 | WP_000854716.1 | TA system toxin CbtA family protein | Toxin |
| N4S17_RS09950 (2045193) | 2045193..2045561 | - | 369 | WP_135278903.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N4S17_RS09955 (2045641) | 2045641..2045862 | - | 222 | WP_000692309.1 | DUF987 domain-containing protein | - |
| N4S17_RS09960 (2045925) | 2045925..2046401 | - | 477 | WP_135258430.1 | RadC family protein | - |
| N4S17_RS09965 (2046417) | 2046417..2046902 | - | 486 | WP_000213718.1 | antirestriction protein | - |
| N4S17_RS09970 (2046994) | 2046994..2047812 | - | 819 | WP_001234704.1 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13986.02 Da Isoelectric Point: 7.2426
>T257999 WP_000854716.1 NZ_CP104472:c2045103-2044729 [Escherichia coli]
MKTLPDTHVREASRCPSPVIIWQILLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYLEAK
MKTLPDTHVREASRCPSPVIIWQILLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYLEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13574.33 Da Isoelectric Point: 6.0600
>AT257999 WP_135278903.1 NZ_CP104472:c2045561-2045193 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPTPETKK
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|