Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1922330..1923128 Replicon chromosome
Accession NZ_CP104472
Organism Escherichia coli strain UC4224

Toxin (Protein)


Gene name yeeV Uniprot ID A0A1M0ZYM8
Locus tag N4S17_RS09355 Protein ID WP_000854904.1
Coordinates 1922751..1923128 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A093DMQ4
Locus tag N4S17_RS09350 Protein ID WP_001280952.1
Coordinates 1922330..1922704 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4S17_RS09310 (1917753) 1917753..1918658 + 906 Protein_1826 IS3 family transposase -
N4S17_RS09315 (1918669) 1918669..1919103 + 435 Protein_1827 hypothetical protein -
N4S17_RS09320 (1919179) 1919179..1919634 + 456 WP_000581504.1 IrmA family protein -
N4S17_RS09325 (1919713) 1919713..1919946 + 234 WP_001119729.1 DUF905 family protein -
N4S17_RS09330 (1920033) 1920033..1920851 + 819 WP_062865682.1 DUF932 domain-containing protein -
N4S17_RS09335 (1920906) 1920906..1921391 + 486 WP_000849591.1 antirestriction protein -
N4S17_RS09340 (1921407) 1921407..1921883 + 477 WP_001186726.1 RadC family protein -
N4S17_RS09345 (1921946) 1921946..1922167 + 222 WP_000692311.1 DUF987 domain-containing protein -
N4S17_RS09350 (1922330) 1922330..1922704 + 375 WP_001280952.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
N4S17_RS09355 (1922751) 1922751..1923128 + 378 WP_000854904.1 TA system toxin CbtA family protein Toxin
N4S17_RS09360 (1923125) 1923125..1923613 + 489 WP_000779174.1 DUF5983 family protein -
N4S17_RS09365 (1923625) 1923625..1923822 + 198 WP_000839249.1 DUF957 domain-containing protein -
N4S17_RS09370 (1923907) 1923907..1924749 + 843 Protein_1838 DUF4942 domain-containing protein -
N4S17_RS09375 (1925092) 1925092..1925628 - 537 WP_000942795.1 GspM family type II secretion system protein YghD -
N4S17_RS09380 (1925630) 1925630..1926808 - 1179 WP_000094971.1 type II secretion system protein GspL -
N4S17_RS09385 (1926805) 1926805..1927785 - 981 WP_261306975.1 type II secretion system minor pseudopilin GspK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - gspM / gspL / gspK / gspJ / gspI / gspH / gspG / gspF / gspE / gspD / gspC 1847071..1984652 137581


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-118)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14280.26 Da        Isoelectric Point: 7.2922

>T257998 WP_000854904.1 NZ_CP104472:1922751-1923128 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13719.50 Da        Isoelectric Point: 6.6249

>AT257998 WP_001280952.1 NZ_CP104472:1922330-1922704 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRNQHTVTLYAKGLTCEADTLGSCGYVYLAVYPAQAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1M0ZYM8

Antitoxin

Source ID Structure
AlphaFold DB A0A093DMQ4

References