Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 3541995..3542517 | Replicon | chromosome |
Accession | NZ_CP104371 | ||
Organism | Escherichia coli strain 2021CK-01784 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A829L6G8 |
Locus tag | N4502_RS17065 | Protein ID | WP_001105433.1 |
Coordinates | 3542227..3542517 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V0SC69 |
Locus tag | N4502_RS17060 | Protein ID | WP_000212715.1 |
Coordinates | 3541995..3542237 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4502_RS17040 (3537908) | 3537908..3539281 | + | 1374 | WP_001219792.1 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase | - |
N4502_RS17045 (3539364) | 3539364..3539915 | - | 552 | WP_000166270.1 | ribosome biogenesis factor YjgA | - |
N4502_RS17050 (3540009) | 3540009..3541361 | + | 1353 | WP_039720329.1 | metalloprotease PmbA | - |
N4502_RS17055 (3541417) | 3541417..3541803 | + | 387 | WP_001232253.1 | cytochrome b562 | - |
N4502_RS17060 (3541995) | 3541995..3542237 | + | 243 | WP_000212715.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
N4502_RS17065 (3542227) | 3542227..3542517 | + | 291 | WP_001105433.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N4502_RS17070 (3542518) | 3542518..3542982 | - | 465 | WP_260837258.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
N4502_RS17075 (3543168) | 3543168..3545306 | - | 2139 | WP_000187798.1 | anaerobic ribonucleoside-triphosphate reductase | - |
N4502_RS17080 (3545700) | 3545700..3547355 | - | 1656 | WP_001305655.1 | alpha,alpha-phosphotrehalase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11367.23 Da Isoelectric Point: 10.0238
>T257810 WP_001105433.1 NZ_CP104371:3542227-3542517 [Escherichia coli]
MNYELAFDPRALKEWQKLGVTVREQFKKKLEDVLKRPRNPSAKLRDLPDCYKIKLRTQGYRLVYQVNDKELLVLVIAIGK
RENSAVYEDATKRLDE
MNYELAFDPRALKEWQKLGVTVREQFKKKLEDVLKRPRNPSAKLRDLPDCYKIKLRTQGYRLVYQVNDKELLVLVIAIGK
RENSAVYEDATKRLDE
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829L6G8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9H4B3 |