Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3411690..3412310 | Replicon | chromosome |
| Accession | NZ_CP104358 | ||
| Organism | Salmonella enterica strain PNUSAS119065 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | N4275_RS16805 | Protein ID | WP_001280991.1 |
| Coordinates | 3412092..3412310 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | N4275_RS16800 | Protein ID | WP_000344807.1 |
| Coordinates | 3411690..3412064 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4275_RS16790 (3406829) | 3406829..3408022 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| N4275_RS16795 (3408045) | 3408045..3411194 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| N4275_RS16800 (3411690) | 3411690..3412064 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| N4275_RS16805 (3412092) | 3412092..3412310 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| N4275_RS16810 (3412489) | 3412489..3413040 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| N4275_RS16815 (3413158) | 3413158..3413628 | + | 471 | WP_000136183.1 | YlaC family protein | - |
| N4275_RS16820 (3413684) | 3413684..3413824 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| N4275_RS16825 (3413830) | 3413830..3414090 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| N4275_RS16830 (3414315) | 3414315..3415865 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
| N4275_RS16840 (3416096) | 3416096..3416485 | + | 390 | WP_000961287.1 | MGMT family protein | - |
| N4275_RS16845 (3416518) | 3416518..3417087 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T257745 WP_001280991.1 NZ_CP104358:3412092-3412310 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT257745 WP_000344807.1 NZ_CP104358:3411690-3412064 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|