Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1255126..1255805 | Replicon | chromosome |
| Accession | NZ_CP104342 | ||
| Organism | Acinetobacter baumannii strain 2021CK-01300 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S3TWT7 |
| Locus tag | N4T35_RS06400 | Protein ID | WP_000838146.1 |
| Coordinates | 1255126..1255308 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | N9L2H6 |
| Locus tag | N4T35_RS06405 | Protein ID | WP_000966688.1 |
| Coordinates | 1255401..1255805 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4T35_RS06360 (N4T35_06360) | 1250300..1250470 | + | 171 | WP_000220307.1 | hypothetical protein | - |
| N4T35_RS06365 (N4T35_06365) | 1250481..1250888 | + | 408 | WP_000255076.1 | hypothetical protein | - |
| N4T35_RS06370 (N4T35_06370) | 1250860..1251228 | + | 369 | WP_063558585.1 | hypothetical protein | - |
| N4T35_RS06375 (N4T35_06375) | 1251230..1251628 | + | 399 | WP_001251844.1 | phage tail terminator-like protein | - |
| N4T35_RS06380 (N4T35_06380) | 1251697..1252050 | + | 354 | WP_063558502.1 | hypothetical protein | - |
| N4T35_RS06385 (N4T35_06385) | 1252050..1253201 | + | 1152 | WP_063558501.1 | hypothetical protein | - |
| N4T35_RS06390 (N4T35_06390) | 1253298..1254215 | + | 918 | WP_075149897.1 | phage tail tube protein | - |
| N4T35_RS06395 (N4T35_06395) | 1254285..1254800 | + | 516 | WP_001185602.1 | hypothetical protein | - |
| N4T35_RS06400 (N4T35_06400) | 1255126..1255308 | + | 183 | WP_000838146.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N4T35_RS06405 (N4T35_06405) | 1255401..1255805 | + | 405 | WP_000966688.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| N4T35_RS06410 (N4T35_06410) | 1255904..1256080 | + | 177 | WP_001983384.1 | hypothetical protein | - |
| N4T35_RS06415 (N4T35_06415) | 1256089..1256412 | + | 324 | WP_260785404.1 | DUF4236 domain-containing protein | - |
| N4T35_RS06420 (N4T35_06420) | 1256445..1257128 | + | 684 | WP_000720504.1 | hypothetical protein | - |
| N4T35_RS06425 (N4T35_06425) | 1257200..1257526 | + | 327 | WP_000721696.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1225318..1274407 | 49089 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6695.84 Da Isoelectric Point: 10.5523
>T257690 WP_000838146.1 NZ_CP104342:1255126-1255308 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14647.69 Da Isoelectric Point: 4.4328
>AT257690 WP_000966688.1 NZ_CP104342:1255401-1255805 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|