Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumA-relB/upstrm_HI1419-dnstrm_HI1420
Location 50128..50712 Replicon plasmid unnamed2
Accession NZ_CP104339
Organism Acinetobacter baumannii strain 2021CK-01409

Toxin (Protein)


Gene name PumA Uniprot ID N8Q7V3
Locus tag N4T41_RS00340 Protein ID WP_000286964.1
Coordinates 50410..50712 (-) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag N4T41_RS00335 Protein ID WP_000985609.1
Coordinates 50128..50409 (-) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4T41_RS00305 (N4T41_00305) 45195..45806 + 612 WP_015060246.1 recombinase family protein -
N4T41_RS00310 (N4T41_00310) 45996..46880 - 885 WP_000155092.1 Mph(E) family macrolide 2'-phosphotransferase -
N4T41_RS00315 (N4T41_00315) 46936..48411 - 1476 WP_000052512.1 ABC-F type ribosomal protection protein Msr(E) -
N4T41_RS00320 (N4T41_00320) 48904..49176 - 273 WP_000369781.1 NadS family protein -
N4T41_RS00325 (N4T41_00325) 49169..49489 - 321 WP_000897307.1 type II toxin-antitoxin system RelE/ParE family toxin -
N4T41_RS00330 (N4T41_00330) 49629..50048 + 420 WP_001180106.1 SMI1/KNR4 family protein -
N4T41_RS00335 (N4T41_00335) 50128..50409 - 282 WP_000985609.1 putative addiction module antidote protein Antitoxin
N4T41_RS00340 (N4T41_00340) 50410..50712 - 303 WP_000286964.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N4T41_RS00345 (N4T41_00345) 50914..51882 - 969 WP_252513945.1 IS30 family transposase -
N4T41_RS00350 (N4T41_00350) 51960..52403 + 444 WP_260744098.1 hypothetical protein -
N4T41_RS00355 (N4T41_00355) 52570..52884 - 315 WP_004728120.1 BrnA antitoxin family protein -
N4T41_RS00360 (N4T41_00360) 52871..53158 - 288 WP_000438825.1 BrnT family toxin -
N4T41_RS00365 (N4T41_00365) 53348..54184 - 837 WP_040110386.1 APH(6)-I family aminoglycoside O-phosphotransferase -
N4T41_RS00370 (N4T41_00370) 54184..54987 - 804 WP_001082319.1 aminoglycoside O-phosphotransferase APH(3'')-Ib -
N4T41_RS00375 (N4T41_00375) 55053..55667 - 615 WP_125281634.1 recombinase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaNDM-1 / sul1 / qacE / ARR-3 / mph(E) / msr(E) / aph(6)-Id / aph(3'')-Ib / sul2 / tet(X3) / blaOXA-58 - 1..329791 329791
- inside IScluster/Tn mph(E) / msr(E) / aph(6)-Id / aph(3'')-Ib - 45996..63825 17829


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-90)

Antitoxin

Uncharacterized protein HI1420

(4-91)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11573.07 Da        Isoelectric Point: 4.6838

>T257684 WP_000286964.1 NZ_CP104339:c50712-50410 [Acinetobacter baumannii]
MYSIYTTEVFDDWFTKLKDQQAKRRIQVRIDRVEDGNFGDTEPVGEGVSELRFFFGPGYRIYYCKQGQRVVILLAGGDKS
TQSKDIKLALQLAQDLEEEL

Download         Length: 303 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10109.67 Da        Isoelectric Point: 8.0018

>AT257684 WP_000985609.1 NZ_CP104339:c50409-50128 [Acinetobacter baumannii]
MAIKLRKWDSAEHLKTEDDMQAYLQACIEESNGDAAFIAKALGNIAKAKGMAQLSRDTGLGRESLYKALSGDVNPSFDTV
IKVVKALNLRLAI

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0A8TV94

Antitoxin

Source ID Structure

References