Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicB(antitoxin)
Location 3303616..3304247 Replicon chromosome
Accession NZ_CP104312
Organism Klebsiella pneumoniae strain KP8132

Toxin (Protein)


Gene name hicA Uniprot ID A0A1Q8YTV3
Locus tag N2X67_RS16495 Protein ID WP_012542177.1
Coordinates 3304071..3304247 (-) Length 59 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A3Q9U6R4
Locus tag N2X67_RS16490 Protein ID WP_017898984.1
Coordinates 3303616..3304023 (-) Length 136 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N2X67_RS16455 (N2X67_16455) 3298980..3299414 - 435 WP_012542168.1 phage terminase small subunit P27 family -
N2X67_RS16460 (N2X67_16460) 3299662..3300093 - 432 WP_023279521.1 hypothetical protein -
N2X67_RS16465 (N2X67_16465) 3300090..3300407 - 318 WP_023279522.1 hypothetical protein -
N2X67_RS16470 (N2X67_16470) 3300359..3300721 - 363 WP_014228901.1 HNH endonuclease -
N2X67_RS16475 (N2X67_16475) 3301846..3302196 - 351 WP_017898986.1 hypothetical protein -
N2X67_RS16480 (N2X67_16480) 3302193..3302690 - 498 WP_023279523.1 lysozyme -
N2X67_RS16485 (N2X67_16485) 3302690..3302905 - 216 WP_017880269.1 class II holin family protein -
N2X67_RS16490 (N2X67_16490) 3303616..3304023 - 408 WP_017898984.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
N2X67_RS16495 (N2X67_16495) 3304071..3304247 - 177 WP_012542177.1 type II toxin-antitoxin system HicA family toxin Toxin
N2X67_RS16500 (N2X67_16500) 3304611..3306395 + 1785 WP_032415155.1 ATP-binding protein -
N2X67_RS16505 (N2X67_16505) 3306415..3307449 + 1035 WP_219071718.1 DNA cytosine methyltransferase -
N2X67_RS16510 (N2X67_16510) 3307474..3307815 - 342 WP_017898982.1 antiterminator Q family protein -
N2X67_RS16515 (N2X67_16515) 3307828..3308859 - 1032 WP_071058942.1 DUF968 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3270147..3325264 55117


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-57)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-61)


Sequences

Toxin        


Download         Length: 59 a.a.        Molecular weight: 6632.83 Da        Isoelectric Point: 11.0174

>T257565 WP_012542177.1 NZ_CP104312:c3304247-3304071 [Klebsiella pneumoniae]
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK

Download         Length: 177 bp

Antitoxin


Download         Length: 136 a.a.        Molecular weight: 14959.96 Da        Isoelectric Point: 4.4277

>AT257565 WP_017898984.1 NZ_CP104312:c3304023-3303616 [Klebsiella pneumoniae]
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSAEGDAFVEVPASVAAKVLLL
NRLVSTNTSNADLARLINTRPQEVQRIVSLGHSTKIDTIQKALSALGQKMEIVVH

Download         Length: 408 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1Q8YTV3

Antitoxin

Source ID Structure
AlphaFold DB A0A3Q9U6R4

References