Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symE-timR/SymE(toxin) |
| Location | 4163416..4163828 | Replicon | chromosome |
| Accession | NZ_CP104274 | ||
| Organism | Escherichia coli strain Ec15103 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | S1NWQ7 |
| Locus tag | N2O69_RS20415 | Protein ID | WP_000132614.1 |
| Coordinates | 4163487..4163828 (+) | Length | 114 a.a. |
Antitoxin (RNA)
| Gene name | timR | ||
| Locus tag | - | ||
| Coordinates | 4163416..4163492 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2O69_RS20405 (4160028) | 4160028..4161497 | + | 1470 | WP_001387312.1 | type I restriction-modification system subunit M | - |
| N2O69_RS20410 (4161497) | 4161497..4163266 | + | 1770 | WP_001513535.1 | restriction endonuclease subunit S | - |
| - (4163416) | 4163416..4163492 | - | 77 | NuclAT_8 | - | Antitoxin |
| - (4163416) | 4163416..4163492 | - | 77 | NuclAT_8 | - | Antitoxin |
| - (4163416) | 4163416..4163492 | - | 77 | NuclAT_8 | - | Antitoxin |
| - (4163416) | 4163416..4163492 | - | 77 | NuclAT_8 | - | Antitoxin |
| - (4163416) | 4163416..4163492 | - | 77 | NuclAT_9 | - | Antitoxin |
| - (4163416) | 4163416..4163492 | - | 77 | NuclAT_9 | - | Antitoxin |
| - (4163416) | 4163416..4163492 | - | 77 | NuclAT_9 | - | Antitoxin |
| - (4163416) | 4163416..4163492 | - | 77 | NuclAT_9 | - | Antitoxin |
| N2O69_RS20415 (4163487) | 4163487..4163828 | + | 342 | WP_000132614.1 | endoribonuclease SymE | Toxin |
| N2O69_RS20420 (4163875) | 4163875..4165038 | - | 1164 | WP_224153787.1 | DUF1524 domain-containing protein | - |
| N2O69_RS20425 (4165092) | 4165092..4165968 | - | 877 | Protein_3998 | DUF262 domain-containing protein | - |
| N2O69_RS20430 (4166374) | 4166374..4167294 | - | 921 | WP_001513532.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| N2O69_RS20435 (4167479) | 4167479..4168759 | + | 1281 | WP_001338077.1 | DUF445 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | cheD | 4147804..4163828 | 16024 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12266.07 Da Isoelectric Point: 8.4982
>T257449 WP_000132614.1 NZ_CP104274:4163487-4163828 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT257449 NZ_CP104274:c4163492-4163416 [Escherichia coli]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|