Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
Location | 2003092..2003667 | Replicon | chromosome |
Accession | NZ_CP104215 | ||
Organism | Burkholderia gladioli strain ZN-S4 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NYZ96_RS27370 | Protein ID | WP_036054553.1 |
Coordinates | 2003380..2003667 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A560UNM0 |
Locus tag | NYZ96_RS27365 | Protein ID | WP_036030606.1 |
Coordinates | 2003092..2003376 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYZ96_RS27345 (NYZ96_27345) | 1998172..1999455 | - | 1284 | WP_260531441.1 | 4-aminobutyrate--2-oxoglutarate transaminase | - |
NYZ96_RS27350 (NYZ96_27350) | 1999591..2001246 | + | 1656 | WP_172877029.1 | PLP-dependent aminotransferase family protein | - |
NYZ96_RS27355 (NYZ96_27355) | 2001384..2002559 | + | 1176 | WP_046582019.1 | ABC transporter substrate-binding protein | - |
NYZ96_RS27360 (NYZ96_27360) | 2002708..2003034 | + | 327 | WP_186016973.1 | hypothetical protein | - |
NYZ96_RS27365 (NYZ96_27365) | 2003092..2003376 | - | 285 | WP_036030606.1 | putative addiction module antidote protein | Antitoxin |
NYZ96_RS27370 (NYZ96_27370) | 2003380..2003667 | - | 288 | WP_036054553.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYZ96_RS27375 (NYZ96_27375) | 2003800..2004738 | - | 939 | WP_046582023.1 | ketopantoate reductase family protein | - |
NYZ96_RS27380 (NYZ96_27380) | 2004896..2005366 | + | 471 | WP_013689305.1 | Lrp/AsnC family transcriptional regulator | - |
NYZ96_RS27385 (NYZ96_27385) | 2005410..2006246 | - | 837 | WP_036054549.1 | DMT family transporter | - |
NYZ96_RS27390 (NYZ96_27390) | 2006465..2007526 | + | 1062 | WP_105827369.1 | selenide, water dikinase SelD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10959.72 Da Isoelectric Point: 10.4966
>T257421 WP_036054553.1 NZ_CP104215:c2003667-2003380 [Burkholderia gladioli]
MLRSSEFTNWLSSLRDQRGKARIAARLISAQLGNFGEYRVIGEGVREMKVDFGPGYRIYYVRRAEIVYVLLCGGDKSTQK
KDIKRALQMARELKE
MLRSSEFTNWLSSLRDQRGKARIAARLISAQLGNFGEYRVIGEGVREMKVDFGPGYRIYYVRRAEIVYVLLCGGDKSTQK
KDIKRALQMARELKE
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|