Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 112298..112940 | Replicon | chromosome |
Accession | NZ_CP104215 | ||
Organism | Burkholderia gladioli strain ZN-S4 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NYZ96_RS19270 | Protein ID | WP_105851412.1 |
Coordinates | 112298..112720 (-) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NYZ96_RS19275 | Protein ID | WP_105827555.1 |
Coordinates | 112707..112940 (-) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYZ96_RS19250 (NYZ96_19250) | 108098..109471 | + | 1374 | WP_046582154.1 | L-fucose:H+ symporter permease | - |
NYZ96_RS19255 (NYZ96_19255) | 109474..110556 | + | 1083 | WP_105827531.1 | aldose 1-epimerase family protein | - |
NYZ96_RS19260 (NYZ96_19260) | 110576..111346 | - | 771 | WP_025101959.1 | DNA-binding transcriptional repressor DeoR | - |
NYZ96_RS19265 (NYZ96_19265) | 111496..112176 | + | 681 | WP_105851413.1 | deoxyribose-phosphate aldolase | - |
NYZ96_RS19270 (NYZ96_19270) | 112298..112720 | - | 423 | WP_105851412.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NYZ96_RS19275 (NYZ96_19275) | 112707..112940 | - | 234 | WP_105827555.1 | DNA-binding protein | Antitoxin |
NYZ96_RS19280 (NYZ96_19280) | 113256..114245 | - | 990 | WP_105850350.1 | LysR substrate-binding domain-containing protein | - |
NYZ96_RS19285 (NYZ96_19285) | 114866..116599 | + | 1734 | WP_241163391.1 | AMP-binding protein | - |
NYZ96_RS19290 (NYZ96_19290) | 116724..116972 | + | 249 | WP_013690725.1 | acyl carrier protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15707.01 Da Isoelectric Point: 9.5579
>T257420 WP_105851412.1 NZ_CP104215:c112720-112298 [Burkholderia gladioli]
MYLIDTNVVSEVRKRDRADKGVMAFFRQAARDDAGLYLSVVTVGELRRGVEIIRHRGDKSQATRLANWLDGVLREFAENI
LVVDKEIGQMWGYLRVPRSEHSLDKVIAATALIHDLTVVTRNVDDFAGTGARVLNPFKGP
MYLIDTNVVSEVRKRDRADKGVMAFFRQAARDDAGLYLSVVTVGELRRGVEIIRHRGDKSQATRLANWLDGVLREFAENI
LVVDKEIGQMWGYLRVPRSEHSLDKVIAATALIHDLTVVTRNVDDFAGTGARVLNPFKGP
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|