Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 5769125..5769736 | Replicon | chromosome |
| Accession | NZ_CP104174 | ||
| Organism | Bradyrhizobium sp. CB1015 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | - |
| Locus tag | N2604_RS26905 | Protein ID | WP_260371149.1 |
| Coordinates | 5769452..5769736 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A150U781 |
| Locus tag | N2604_RS26900 | Protein ID | WP_063195082.1 |
| Coordinates | 5769125..5769442 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2604_RS26880 (N2604_26880) | 5764689..5764952 | - | 264 | WP_025036968.1 | EscU/YscU/HrcU family type III secretion system export apparatus switch protein | - |
| N2604_RS26885 (N2604_26885) | 5764949..5766583 | - | 1635 | WP_260371146.1 | flagellar hook-length control protein FliK | - |
| N2604_RS26890 (N2604_26890) | 5766639..5767433 | - | 795 | WP_260371147.1 | ATP12 family protein | - |
| N2604_RS26895 (N2604_26895) | 5767911..5769128 | - | 1218 | WP_260371148.1 | RluA family pseudouridine synthase | - |
| N2604_RS26900 (N2604_26900) | 5769125..5769442 | - | 318 | WP_063195082.1 | HigA family addiction module antitoxin | Antitoxin |
| N2604_RS26905 (N2604_26905) | 5769452..5769736 | - | 285 | WP_260371149.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N2604_RS26910 (N2604_26910) | 5769794..5771128 | - | 1335 | WP_260371150.1 | replication-associated recombination protein A | - |
| N2604_RS26915 (N2604_26915) | 5771125..5772531 | - | 1407 | WP_260371151.1 | DegQ family serine endoprotease | - |
| N2604_RS26920 (N2604_26920) | 5772848..5774461 | + | 1614 | WP_260371152.1 | OprO/OprP family phosphate-selective porin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10633.93 Da Isoelectric Point: 6.4615
>T257371 WP_260371149.1 NZ_CP104174:c5769736-5769452 [Bradyrhizobium sp. CB1015]
MIVSYRDKRTERFAAGQHVKEFSGFARQAETRLDRLDAATSLADLAALPGNRLEALKGDRAGQFSIRINDQWRICFNWPE
GSPGPIDVEIVDYH
MIVSYRDKRTERFAAGQHVKEFSGFARQAETRLDRLDAATSLADLAALPGNRLEALKGDRAGQFSIRINDQWRICFNWPE
GSPGPIDVEIVDYH
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|