Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-Phd |
| Location | 1133425..1134131 | Replicon | chromosome |
| Accession | NZ_CP104173 | ||
| Organism | Bradyrhizobium sp. CB1024 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | N2605_RS05345 | Protein ID | WP_260345991.1 |
| Coordinates | 1133425..1133850 (-) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | N2605_RS05350 | Protein ID | WP_260345992.1 |
| Coordinates | 1133847..1134131 (-) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2605_RS05320 (N2605_05320) | 1130097..1130504 | + | 408 | WP_036013863.1 | acyl-CoA thioesterase | - |
| N2605_RS05325 (N2605_05325) | 1130737..1130928 | + | 192 | WP_036013862.1 | hypothetical protein | - |
| N2605_RS05330 (N2605_05330) | 1131178..1131630 | - | 453 | WP_036013866.1 | nuclear transport factor 2 family protein | - |
| N2605_RS05335 (N2605_05335) | 1131783..1132469 | + | 687 | WP_260345990.1 | HAD-IA family hydrolase | - |
| N2605_RS05340 (N2605_05340) | 1132576..1133421 | + | 846 | WP_036013860.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| N2605_RS05345 (N2605_05345) | 1133425..1133850 | - | 426 | WP_260345991.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N2605_RS05350 (N2605_05350) | 1133847..1134131 | - | 285 | WP_260345992.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| N2605_RS05355 (N2605_05355) | 1134359..1135909 | + | 1551 | WP_260345993.1 | glycerol-3-phosphate dehydrogenase | - |
| N2605_RS05360 (N2605_05360) | 1135906..1136982 | + | 1077 | WP_057026248.1 | ABC transporter ATP-binding protein | - |
| N2605_RS05365 (N2605_05365) | 1136997..1138082 | + | 1086 | WP_036013850.1 | ABC transporter ATP-binding protein | - |
| N2605_RS05370 (N2605_05370) | 1138082..1139056 | + | 975 | WP_036013849.1 | sugar ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15566.90 Da Isoelectric Point: 4.9055
>T257368 WP_260345991.1 NZ_CP104173:c1133850-1133425 [Bradyrhizobium sp. CB1024]
MNLLLDTNVLSEVQRPAPSPKVVGWLDRIDEDRAFISVASIAELRRGIALLEDGRRRTALAVWLAHDLPARFAERVLPID
QTVAERWGDLMAQSRKSGVALSVMDGFFAATALVNDLTLVTRNVKDFAAFGVPLLNPWDDA
MNLLLDTNVLSEVQRPAPSPKVVGWLDRIDEDRAFISVASIAELRRGIALLEDGRRRTALAVWLAHDLPARFAERVLPID
QTVAERWGDLMAQSRKSGVALSVMDGFFAATALVNDLTLVTRNVKDFAAFGVPLLNPWDDA
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|