Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE(toxin)
Location 1458501..1459023 Replicon plasmid pM103a
Accession NZ_CP104127
Organism Sinorhizobium sp. M103

Toxin (Protein)


Gene name relE Uniprot ID A0A2N8JTE7
Locus tag N0Q90_RS09925 Protein ID WP_018097784.1
Coordinates 1458501..1458788 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A2N8JTF1
Locus tag N0Q90_RS09930 Protein ID WP_026168897.1
Coordinates 1458778..1459023 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N0Q90_RS09905 (N0Q90_09905) 1454739..1455056 + 318 WP_018097788.1 DUF2849 domain-containing protein -
N0Q90_RS09910 (N0Q90_09910) 1455071..1456744 + 1674 WP_100673926.1 nitrite/sulfite reductase -
N0Q90_RS09915 (N0Q90_09915) 1456762..1457262 + 501 WP_275598024.1 DUF934 domain-containing protein -
N0Q90_RS09920 (N0Q90_09920) 1457407..1458219 + 813 WP_018097785.1 ferredoxin--NADP reductase -
N0Q90_RS09925 (N0Q90_09925) 1458501..1458788 - 288 WP_018097784.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N0Q90_RS09930 (N0Q90_09930) 1458778..1459023 - 246 WP_026168897.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N0Q90_RS09935 (N0Q90_09935) 1459261..1460037 - 777 WP_100673924.1 amino acid ABC transporter ATP-binding protein -
N0Q90_RS09940 (N0Q90_09940) 1460054..1461208 - 1155 WP_100673923.1 amino acid ABC transporter permease -
N0Q90_RS09945 (N0Q90_09945) 1461213..1462406 - 1194 WP_275598023.1 amino acid ABC transporter permease -
N0Q90_RS09950 (N0Q90_09950) 1462510..1463535 - 1026 WP_100673922.1 amino acid ABC transporter substrate-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - kdsB / adeG / fliE / fliQ / flhA / icl / htpB / acpXL / tufA / tufA / kdsA / acpXL / pgm 1..3521513 3521513


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(9-76)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11088.01 Da        Isoelectric Point: 11.1450

>T257289 WP_018097784.1 NZ_CP104127:c1458788-1458501 [Sinorhizobium sp. M103]
MPYSLEFLPSARKEWDKLGATIRQQFVKKLRERLERPRIPSAALSGMPDHYKIKLRQLGYRLVYRVDDGTVIVLVVAVGK
RERGDVYNTMRARGR

Download         Length: 288 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 8889.14 Da        Isoelectric Point: 4.1712

>AT257289 WP_026168897.1 NZ_CP104127:c1459023-1458778 [Sinorhizobium sp. M103]
MQRVEASVAVSVSDLKKSPTAVMGEAQGEAVAVLNHNRVMAYLVPAEVYESMLERLDDLYLAELVKERAEEKGEPVDIDA
L

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2N8JTE7

Antitoxin

Source ID Structure
AlphaFold DB A0A2N8JTF1

References