Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 660550..661349 | Replicon | chromosome |
| Accession | NZ_CP104123 | ||
| Organism | Escherichia coli strain USDA-ARS-USMARC-49610 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | V0SSH7 |
| Locus tag | N1705_RS03215 | Protein ID | WP_000347273.1 |
| Coordinates | 660550..661014 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | N1705_RS03220 | Protein ID | WP_001307405.1 |
| Coordinates | 661014..661349 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1705_RS03185 (655551) | 655551..655985 | - | 435 | WP_219411565.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| N1705_RS03190 (656003) | 656003..656881 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| N1705_RS03195 (656871) | 656871..657650 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| N1705_RS03200 (657661) | 657661..658134 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| N1705_RS03205 (658157) | 658157..659437 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| N1705_RS03210 (659686) | 659686..660495 | + | 810 | WP_000072180.1 | aga operon transcriptional regulator AgaR | - |
| N1705_RS03215 (660550) | 660550..661014 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| N1705_RS03220 (661014) | 661014..661349 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| N1705_RS03225 (661498) | 661498..663069 | - | 1572 | WP_001273771.1 | galactarate dehydratase | - |
| N1705_RS03230 (663444) | 663444..664778 | + | 1335 | WP_219411563.1 | galactarate/glucarate/glycerate transporter GarP | - |
| N1705_RS03235 (664794) | 664794..665564 | + | 771 | WP_001058214.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T257264 WP_000347273.1 NZ_CP104123:c661014-660550 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0SSH7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |