Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 13028..13605 Replicon plasmid pPv1-49741
Accession NZ_CP104122
Organism Proteus vulgaris strain USDA-ARS-USMARC-49741

Toxin (Protein)


Gene name mazF Uniprot ID U5N651
Locus tag N1711_RS18135 Protein ID WP_023159957.1
Coordinates 13273..13605 (+) Length 111 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID U5N340
Locus tag N1711_RS18130 Protein ID WP_023159984.1
Coordinates 13028..13273 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N1711_RS18090 (N1711_18090) 8058..8402 + 345 WP_023159966.1 single-stranded DNA-binding protein -
N1711_RS18095 (N1711_18095) 8395..8817 + 423 WP_048821775.1 hypothetical protein -
N1711_RS18100 (N1711_18100) 8827..9219 + 393 WP_048821774.1 hypothetical protein -
N1711_RS18105 (N1711_18105) 9500..9978 + 479 Protein_12 Hcp family type VI secretion system effector -
N1711_RS18110 (N1711_18110) 9987..10565 + 579 WP_048822182.1 hypothetical protein -
N1711_RS18115 (N1711_18115) 11326..11694 + 369 WP_048821769.1 hypothetical protein -
N1711_RS18120 (N1711_18120) 11792..12019 - 228 WP_048821767.1 plasmid partition protein ParG -
N1711_RS18125 (N1711_18125) 12128..12751 - 624 WP_023159958.1 AAA family ATPase -
N1711_RS18130 (N1711_18130) 13028..13273 + 246 WP_023159984.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
N1711_RS18135 (N1711_18135) 13273..13605 + 333 WP_023159957.1 endoribonuclease MazF Toxin
N1711_RS18140 (N1711_18140) 13636..14016 + 381 WP_048821763.1 hypothetical protein -
N1711_RS18145 (N1711_18145) 14105..14245 - 141 WP_072022937.1 Hok/Gef family protein -
N1711_RS18150 (N1711_18150) 14565..15023 - 459 WP_094962568.1 hypothetical protein -
N1711_RS18155 (N1711_18155) 15122..15376 - 255 WP_048821760.1 hypothetical protein -
N1711_RS18160 (N1711_18160) 15415..15684 - 270 WP_048821758.1 hypothetical protein -
N1711_RS18165 (N1711_18165) 16146..16934 + 789 WP_163939961.1 site-specific integrase -
N1711_RS18170 (N1711_18170) 16948..17787 + 840 WP_094962566.1 DUF4365 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(H) / aadA14 / ant(2'')-Ia / sul1 / aph(3')-Ia / floR - 1..93239 93239


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(9-107)

Antitoxin

SpoVT-AbrB domain

(7-49)


Sequences

Toxin        


Download         Length: 111 a.a.        Molecular weight: 12097.88 Da        Isoelectric Point: 7.0813

>T257262 WP_023159957.1 NZ_CP104122:13273-13605 [Proteus vulgaris]
MVSRYVPDSGDLIWIDFDPVEGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTKGKGYPFECELSNERDSYALADQVTCV
DWRARKVTKKGKVEASELAEIKAKAKALIG

Download         Length: 333 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 8786.20 Da        Isoelectric Point: 5.0351

>AT257262 WP_023159984.1 NZ_CP104122:13028-13273 [Proteus vulgaris]
MAQVTVKKWGNSPSVRLPVAIMQKAALSVDDTVEIAVEEGRIIITPVKAVEYSLDNLLAGITPENIHEKVDFGARTGKEL
I

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P1BQ75

Antitoxin

Source ID Structure
AlphaFold DB A0A857E7M9

References