Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 2418005..2418531 | Replicon | chromosome |
| Accession | NZ_CP104114 | ||
| Organism | Escherichia coli strain USDA-ARS-USMARC-51408 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | N1706_RS11655 | Protein ID | WP_000323025.1 |
| Coordinates | 2418005..2418292 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | N1706_RS11660 | Protein ID | WP_000534858.1 |
| Coordinates | 2418292..2418531 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1706_RS11605 (2413029) | 2413029..2413244 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
| N1706_RS11610 (2413464) | 2413464..2413634 | + | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
| N1706_RS11615 (2413998) | 2413998..2414213 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
| N1706_RS11620 (2414514) | 2414514..2414726 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
| N1706_RS11625 (2414781) | 2414781..2414870 | + | 90 | WP_120795389.1 | hypothetical protein | - |
| N1706_RS11630 (2415148) | 2415148..2415900 | - | 753 | WP_001047135.1 | antitermination protein | - |
| N1706_RS11635 (2415914) | 2415914..2416963 | - | 1050 | WP_001265199.1 | DUF968 domain-containing protein | - |
| N1706_RS11640 (2416965) | 2416965..2417243 | - | 279 | WP_012304870.1 | hypothetical protein | - |
| N1706_RS11645 (2417310) | 2417310..2417561 | - | 252 | WP_000980994.1 | protein Rem | - |
| N1706_RS11650 (2417778) | 2417778..2417933 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| N1706_RS11655 (2418005) | 2418005..2418292 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| N1706_RS11660 (2418292) | 2418292..2418531 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| N1706_RS11665 (2418556) | 2418556..2418861 | + | 306 | WP_001326990.1 | protein YdfV | - |
| N1706_RS11670 (2419064) | 2419064..2419396 | + | 333 | WP_001301033.1 | FlxA-like family protein | - |
| N1706_RS11675 (2419833) | 2419833..2419982 | - | 150 | WP_011443592.1 | protein YdfW | - |
| N1706_RS11680 (2420055) | 2420055..2421125 | - | 1071 | Protein_2264 | ISNCY family transposase | - |
| N1706_RS11685 (2421915) | 2421915..2422202 | - | 288 | Protein_2265 | hypothetical protein | - |
| N1706_RS11690 (2422680) | 2422680..2423169 | - | 490 | Protein_2266 | class I SAM-dependent methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2382524..2443403 | 60879 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T257225 WP_000323025.1 NZ_CP104114:c2418292-2418005 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|