Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 3849221..3849948 | Replicon | chromosome |
Accession | NZ_CP104112 | ||
Organism | Escherichia coli strain USDA-ARS-USMARC-51688 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | N1707_RS18815 | Protein ID | WP_000550189.1 |
Coordinates | 3849634..3849948 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N1707_RS18810 | Protein ID | WP_000560255.1 |
Coordinates | 3849221..3849637 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1707_RS18800 (3844481) | 3844481..3846832 | + | 2352 | WP_000695495.1 | alpha-glucosidase | - |
N1707_RS18805 (3847158) | 3847158..3849176 | + | 2019 | WP_112032342.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
N1707_RS18810 (3849221) | 3849221..3849637 | - | 417 | WP_000560255.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
N1707_RS18815 (3849634) | 3849634..3849948 | - | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
N1707_RS18820 (3850233) | 3850233..3851369 | - | 1137 | WP_000018690.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
N1707_RS18825 (3851454) | 3851454..3851956 | + | 503 | Protein_3654 | M48 family metallopeptidase | - |
N1707_RS18830 (3852033) | 3852033..3852716 | + | 684 | WP_001183041.1 | vancomycin high temperature exclusion protein | - |
N1707_RS18835 (3852795) | 3852795..3853781 | + | 987 | WP_000617698.1 | Gfo/Idh/MocA family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T257214 WP_000550189.1 NZ_CP104112:c3849948-3849634 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14951.41 Da Isoelectric Point: 4.5577
>AT257214 WP_000560255.1 NZ_CP104112:c3849637-3849221 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNAPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNAPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|