Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 574161..574419 | Replicon | chromosome |
| Accession | NZ_CP104025 | ||
| Organism | Erwinia amylovora strain Ea915 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | MTP51_RS02505 | Protein ID | WP_231840709.1 |
| Coordinates | 574321..574419 (+) | Length | 33 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 574161..574207 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTP51_RS02465 (MTP51_02465) | 569607..569750 | - | 144 | WP_004160049.1 | hypothetical protein | - |
| MTP51_RS02470 (MTP51_02470) | 570223..570615 | - | 393 | WP_004160048.1 | DoxX family protein | - |
| MTP51_RS02475 (MTP51_02475) | 570825..571106 | - | 282 | WP_004160039.1 | YqjK-like family protein | - |
| MTP51_RS02480 (MTP51_02480) | 571106..571498 | - | 393 | WP_004160038.1 | phage holin family protein | - |
| MTP51_RS02485 (MTP51_02485) | 571500..571805 | - | 306 | WP_004160037.1 | DUF883 family protein | - |
| MTP51_RS02490 (MTP51_02490) | 571848..572219 | - | 372 | WP_004160036.1 | DUF1090 domain-containing protein | - |
| MTP51_RS02495 (MTP51_02495) | 572387..572779 | - | 393 | WP_004160035.1 | EnvZ/OmpR regulon moderator MzrA | - |
| MTP51_RS02500 (MTP51_02500) | 572776..573450 | - | 675 | WP_004160034.1 | DedA family protein | - |
| - | 574161..574207 | - | 47 | - | - | Antitoxin |
| MTP51_RS02505 (MTP51_02505) | 574321..574419 | + | 99 | WP_231840709.1 | Hok/Gef family protein | Toxin |
| MTP51_RS02510 (MTP51_02510) | 574563..575795 | - | 1233 | WP_004160030.1 | serine/threonine transporter SstT | - |
| MTP51_RS02515 (MTP51_02515) | 576030..577010 | - | 981 | WP_013035818.1 | TerC family protein | - |
| MTP51_RS02520 (MTP51_02520) | 577423..579114 | + | 1692 | WP_004160025.1 | chloride channel protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 33 a.a. Molecular weight: 3810.40 Da Isoelectric Point: 8.9407
>T257033 WP_231840709.1 NZ_CP104025:574321-574419 [Erwinia amylovora]
IFTYLTRKSLCEIRYKDGYREVAAFMAYESGK
IFTYLTRKSLCEIRYKDGYREVAAFMAYESGK
Download Length: 99 bp
Antitoxin
Download Length: 47 bp
>AT257033 NZ_CP104025:c574207-574161 [Erwinia amylovora]
GCATGCAGATGGCCTCGTGGATTAATGAAAATTAACTACGGGGCTTT
GCATGCAGATGGCCTCGTGGATTAATGAAAATTAACTACGGGGCTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
