Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 2684615..2685242 | Replicon | chromosome |
| Accession | NZ_CP104022 | ||
| Organism | Erwinia amylovora strain Ea102 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | D2T444 |
| Locus tag | MTP49_RS12115 | Protein ID | WP_004156337.1 |
| Coordinates | 2685024..2685242 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | MTP49_RS12110 | Protein ID | WP_013035913.1 |
| Coordinates | 2684615..2685004 (+) | Length | 130 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTP49_RS12090 (MTP49_12090) | 2679634..2682780 | + | 3147 | WP_004156353.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| MTP49_RS12095 (MTP49_12095) | 2682928..2683209 | + | 282 | WP_004156350.1 | type B 50S ribosomal protein L31 | - |
| MTP49_RS12100 (MTP49_12100) | 2683197..2683343 | + | 147 | WP_004156349.1 | type B 50S ribosomal protein L36 | - |
| MTP49_RS12105 (MTP49_12105) | 2684115..2684468 | + | 354 | WP_004156342.1 | hypothetical protein | - |
| MTP49_RS12110 (MTP49_12110) | 2684615..2685004 | + | 390 | WP_013035913.1 | Hha toxicity modulator TomB | Antitoxin |
| MTP49_RS12115 (MTP49_12115) | 2685024..2685242 | + | 219 | WP_004156337.1 | HHA domain-containing protein | Toxin |
| MTP49_RS12125 (MTP49_12125) | 2685542..2685859 | + | 318 | WP_168397246.1 | MGMT family protein | - |
| MTP49_RS12130 (MTP49_12130) | 2685882..2686439 | - | 558 | WP_004156333.1 | YbaY family lipoprotein | - |
| MTP49_RS12135 (MTP49_12135) | 2686664..2687524 | + | 861 | WP_004156324.1 | acyl-CoA thioesterase II | - |
| MTP49_RS12140 (MTP49_12140) | 2687599..2688900 | - | 1302 | WP_004172214.1 | ammonium transporter AmtB | - |
| MTP49_RS12145 (MTP49_12145) | 2688918..2689256 | - | 339 | WP_004156319.1 | P-II family nitrogen regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8627.06 Da Isoelectric Point: 8.9007
>T257029 WP_004156337.1 NZ_CP104022:2685024-2685242 [Erwinia amylovora]
MTDKLLTKTDYLMRLRRCRSIDTLERVIEKNKYELSDDELAVFYSAADHRLAELTMNKLYDKVPVAVWKFVR
MTDKLLTKTDYLMRLRRCRSIDTLERVIEKNKYELSDDELAVFYSAADHRLAELTMNKLYDKVPVAVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 130 a.a. Molecular weight: 14965.70 Da Isoelectric Point: 4.7040
>AT257029 WP_013035913.1 NZ_CP104022:2684615-2685004 [Erwinia amylovora]
MDEYSPKRHDIAQLKFLCENLYDESLATLGDSHHGWVNDPTSTSNLQLNDLIEHIAAFTMNYKIKHIEDSDLISQIDEYL
DDTFMLFSNYGVNNLDLQRWQKSAKRLFNIFAKECVMSQIQSSHSFSSP
MDEYSPKRHDIAQLKFLCENLYDESLATLGDSHHGWVNDPTSTSNLQLNDLIEHIAAFTMNYKIKHIEDSDLISQIDEYL
DDTFMLFSNYGVNNLDLQRWQKSAKRLFNIFAKECVMSQIQSSHSFSSP
Download Length: 390 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|