Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 12697..13222 | Replicon | plasmid pDLI.5a |
| Accession | NZ_CP103973 | ||
| Organism | Escherichia coli strain DLI.5a | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1PFV8 |
| Locus tag | NZD79_RS24335 | Protein ID | WP_001159871.1 |
| Coordinates | 12917..13222 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | NZD79_RS24330 | Protein ID | WP_000813634.1 |
| Coordinates | 12697..12915 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NZD79_RS24305 (NZD79_24305) | 8218..9168 | - | 951 | WP_032304890.1 | virulence factor VirK | - |
| NZD79_RS24310 (NZD79_24310) | 9173..10261 | - | 1089 | WP_001388979.1 | putative hexosyltransferase CapU | - |
| NZD79_RS24315 (NZD79_24315) | 10264..11106 | - | 843 | WP_160371899.1 | polysaccharide deacetylase family protein | - |
| NZD79_RS24320 (NZD79_24320) | 11350..11919 | - | 570 | WP_032304866.1 | hypothetical protein | - |
| NZD79_RS24325 (NZD79_24325) | 11919..12176 | - | 258 | WP_032304865.1 | hypothetical protein | - |
| NZD79_RS24330 (NZD79_24330) | 12697..12915 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| NZD79_RS24335 (NZD79_24335) | 12917..13222 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| NZD79_RS24340 (NZD79_24340) | 13223..14029 | + | 807 | WP_032304863.1 | site-specific integrase | - |
| NZD79_RS24345 (NZD79_24345) | 14209..14853 | + | 645 | WP_032266348.1 | ParA family protein | - |
| NZD79_RS24350 (NZD79_24350) | 14940..15248 | + | 309 | WP_032266350.1 | hypothetical protein | - |
| NZD79_RS24355 (NZD79_24355) | 15501..16198 | + | 698 | WP_259568234.1 | IS1 family transposase | - |
| NZD79_RS24360 (NZD79_24360) | 16692..17192 | - | 501 | WP_032304856.1 | helix-turn-helix domain-containing protein | - |
| NZD79_RS24365 (NZD79_24365) | 17417..18181 | - | 765 | WP_000104222.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | etpB | 1..57095 | 57095 | |
| - | flank | IS/Tn | - | - | 15695..16198 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T256935 WP_001159871.1 NZ_CP103973:12917-13222 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CCE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3TCJ | |
| PDB | 2H3A | |
| PDB | 2ADN | |
| PDB | 2ADL | |
| PDB | 3HPW | |
| PDB | 2H3C | |
| PDB | 3G7Z | |
| AlphaFold DB | A0A829CQY2 |