Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 180508..181146 | Replicon | chromosome |
| Accession | NZ_CP103972 | ||
| Organism | Escherichia coli strain DLI.5a | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | NZD79_RS00875 | Protein ID | WP_000813794.1 |
| Coordinates | 180508..180684 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NZD79_RS00880 | Protein ID | WP_001270286.1 |
| Coordinates | 180730..181146 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NZD79_RS00855 (176127) | 176127..177302 | - | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
| NZD79_RS00860 (177394) | 177394..177930 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| NZD79_RS00865 (178003) | 178003..179964 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| NZD79_RS00870 (180056) | 180056..180286 | - | 231 | WP_000494244.1 | YncJ family protein | - |
| NZD79_RS00875 (180508) | 180508..180684 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| NZD79_RS00880 (180730) | 180730..181146 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| NZD79_RS00885 (181225) | 181225..182631 | + | 1407 | WP_259568179.1 | PLP-dependent aminotransferase family protein | - |
| NZD79_RS00890 (182876) | 182876..184021 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| NZD79_RS00895 (184039) | 184039..185052 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| NZD79_RS00900 (185053) | 185053..185994 | + | 942 | WP_097342115.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T256917 WP_000813794.1 NZ_CP103972:180508-180684 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT256917 WP_001270286.1 NZ_CP103972:180730-181146 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|