Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higB-toxA/Tad-couple_hipB |
| Location | 2295296..2295938 | Replicon | chromosome |
| Accession | NZ_CP103832 | ||
| Organism | Actinobacillus equuli subsp. haemolyticus strain 798 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | K0GF68 |
| Locus tag | NYR88_RS10805 | Protein ID | WP_005621659.1 |
| Coordinates | 2295296..2295667 (+) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | toxA | Uniprot ID | - |
| Locus tag | NYR88_RS10810 | Protein ID | WP_039198813.1 |
| Coordinates | 2295648..2295938 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR88_RS10790 (NYR88_10790) | 2291802..2292656 | + | 855 | WP_279444366.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
| NYR88_RS10795 (NYR88_10795) | 2292700..2293269 | - | 570 | WP_279441422.1 | elongation factor P hydroxylase | - |
| NYR88_RS10800 (NYR88_10800) | 2293328..2295076 | - | 1749 | WP_279444367.1 | protein-disulfide reductase DsbD | - |
| NYR88_RS10805 (NYR88_10805) | 2295296..2295667 | + | 372 | WP_005621659.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NYR88_RS10810 (NYR88_10810) | 2295648..2295938 | + | 291 | WP_039198813.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| NYR88_RS10815 (NYR88_10815) | 2296006..2296968 | - | 963 | WP_279442035.1 | calcium/sodium antiporter | - |
| NYR88_RS10820 (NYR88_10820) | 2297041..2297538 | + | 498 | WP_015674483.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
| NYR88_RS10825 (NYR88_10825) | 2297762..2298496 | + | 735 | WP_279444368.1 | arginine ABC transporter ATP-binding protein ArtP | - |
| NYR88_RS10830 (NYR88_10830) | 2298516..2299235 | + | 720 | WP_279444369.1 | transporter substrate-binding domain-containing protein | - |
| NYR88_RS10835 (NYR88_10835) | 2299241..2299912 | + | 672 | WP_279444370.1 | arginine ABC transporter permease ArtQ | - |
| NYR88_RS10840 (NYR88_10840) | 2299912..2300596 | + | 685 | Protein_2082 | arginine ABC transporter permease ArtM | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 14938.10 Da Isoelectric Point: 9.5717
>T256775 WP_005621659.1 NZ_CP103832:2295296-2295667 [Actinobacillus equuli subsp. haemolyticus]
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|