Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 1977397..1978047 | Replicon | chromosome |
Accession | NZ_CP103817 | ||
Organism | Actinobacillus equuli subsp. equuli strain 4005 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NYR71_RS09035 | Protein ID | WP_279439544.1 |
Coordinates | 1977397..1977738 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NYR71_RS09040 | Protein ID | WP_279439545.1 |
Coordinates | 1977739..1978047 (+) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR71_RS09020 (NYR71_09020) | 1972968..1973684 | + | 717 | WP_005605560.1 | amino acid ABC transporter permease | - |
NYR71_RS09025 (NYR71_09025) | 1973706..1974455 | + | 750 | WP_279439542.1 | amino acid ABC transporter ATP-binding protein | - |
NYR71_RS09030 (NYR71_09030) | 1974621..1977215 | + | 2595 | WP_279439543.1 | DNA mismatch repair protein MutS | - |
NYR71_RS09035 (NYR71_09035) | 1977397..1977738 | + | 342 | WP_279439544.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYR71_RS09040 (NYR71_09040) | 1977739..1978047 | + | 309 | WP_279439545.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
NYR71_RS09045 (NYR71_09045) | 1978187..1978501 | + | 315 | WP_005619625.1 | ribosome silencing factor | - |
NYR71_RS09050 (NYR71_09050) | 1978524..1978991 | + | 468 | WP_005598965.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
NYR71_RS09055 (NYR71_09055) | 1979074..1981044 | + | 1971 | WP_279439546.1 | penicillin-binding protein 2 | - |
NYR71_RS09060 (NYR71_09060) | 1981037..1982161 | + | 1125 | WP_039198374.1 | rod shape-determining protein RodA | - |
NYR71_RS09065 (NYR71_09065) | 1982336..1982902 | + | 567 | WP_039198375.1 | septal ring lytic transglycosylase RlpA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13344.27 Da Isoelectric Point: 9.8646
>T256723 WP_279439544.1 NZ_CP103817:1977397-1977738 [Actinobacillus equuli subsp. equuli]
VKLVFVELPPFDKFRYENLTDDDYREFQEYLMNNPEAGDIVQGVNGLRKIRISTQAKGKKGGARVIYYYYVRGSQIWLFT
GYNKSRKIDLNSMERRAFSKVLEHLKNIADREL
VKLVFVELPPFDKFRYENLTDDDYREFQEYLMNNPEAGDIVQGVNGLRKIRISTQAKGKKGGARVIYYYYVRGSQIWLFT
GYNKSRKIDLNSMERRAFSKVLEHLKNIADREL
Download Length: 342 bp
Antitoxin
Download Length: 103 a.a. Molecular weight: 11618.45 Da Isoelectric Point: 7.2032
>AT256723 WP_279439545.1 NZ_CP103817:1977739-1978047 [Actinobacillus equuli subsp. equuli]
MGRLFDDLMEGAEALEQYLQGKITLRTTVLEKPEPIELSPSEVKSIREKLNLSQAVFAHKLHTSVRTYQGWEQGKTKPNP
QATLLLRMVDKSPQLLEQMAQL
MGRLFDDLMEGAEALEQYLQGKITLRTTVLEKPEPIELSPSEVKSIREKLNLSQAVFAHKLHTSVRTYQGWEQGKTKPNP
QATLLLRMVDKSPQLLEQMAQL
Download Length: 309 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|