Detailed information of TA system TA256498

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 75765..76191
• Replicon: plasmid pMB2791_1
• Accession: NZ_CP103746
• Organism: Escherichia coli strain 3090

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: M5T02_RS24065
• Protein ID: WP_001372321.1
• Coordinates: 75765..75890 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	75967..76191 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M5T02_RS24025 (71134)	71134..71823	-	690	WP_039002187.1	conjugal transfer transcriptional regulator TraJ	-
M5T02_RS24030 (72010)	72010..72393	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
M5T02_RS24035 (72714)	72714..73316	+	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
M5T02_RS24040 (73613)	73613..74434	-	822	WP_072795862.1	DUF932 domain-containing protein	-
M5T02_RS24045 (74556)	74556..74843	-	288	WP_000107535.1	hypothetical protein	-
M5T02_RS24050 (74868)	74868..75074	-	207	WP_000547968.1	hypothetical protein	-
M5T02_RS24055 (75144)	75144..75317	+	174	Protein_85	hypothetical protein	-
M5T02_RS24060 (75315)	75315..75545	-	231	WP_001426396.1	hypothetical protein	-
M5T02_RS24065 (75765)	75765..75890	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
M5T02_RS24070 (75832)	75832..75981	-	150	Protein_88	plasmid maintenance protein Mok	-
- (75967)	75967..76191	-	225	NuclAT_0	-	Antitoxin
- (75967)	75967..76191	-	225	NuclAT_0	-	Antitoxin
- (75967)	75967..76191	-	225	NuclAT_0	-	Antitoxin
- (75967)	75967..76191	-	225	NuclAT_0	-	Antitoxin
M5T02_RS24075 (76003)	76003..76191	+	189	WP_001299721.1	hypothetical protein	-
M5T02_RS24080 (76160)	76160..76922	-	763	Protein_90	plasmid SOS inhibition protein A	-
M5T02_RS24085 (76919)	76919..77353	-	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
M5T02_RS24090 (77408)	77408..79366	-	1959	WP_039000998.1	ParB/RepB/Spo0J family partition protein	-
M5T02_RS24095 (79431)	79431..79664	-	234	WP_000005987.1	DUF905 family protein	-
M5T02_RS24100 (79721)	79721..80218	-	498	WP_225856491.1	single-stranded DNA-binding protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	ant(3'')-Ia / lnu(F) / sul2 / floR / dfrA12 / aadA2 / cmlA1 / tet(M) / aac(3)-IId	-	1..120324	120324

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T256498 WP_001372321.1 NZ_CP103746:c75890-75765 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT256498 NZ_CP103746:c76191-75967 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin