Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 40466..40720 Replicon plasmid pMB2791_1
Accession NZ_CP103746
Organism Escherichia coli strain 3090

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag M5T02_RS23870 Protein ID WP_001312851.1
Coordinates 40466..40615 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 40659..40720 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T02_RS23835 (36487) 36487..36987 + 501 Protein_41 Tn3 family transposase -
M5T02_RS23840 (37021) 37021..37209 + 189 Protein_42 IS3 family transposase -
M5T02_RS23845 (37284) 37284..37571 - 288 WP_000222766.1 type II toxin-antitoxin system RelE/ParE family toxin -
M5T02_RS23850 (37568) 37568..37819 - 252 WP_001132900.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
M5T02_RS23855 (38785) 38785..39642 - 858 WP_039002220.1 incFII family plasmid replication initiator RepA -
M5T02_RS23860 (39635) 39635..39709 - 75 WP_061357229.1 RepA leader peptide Tap -
M5T02_RS23865 (39941) 39941..40198 - 258 WP_001541895.1 replication regulatory protein RepA -
M5T02_RS23870 (40466) 40466..40615 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (40659) 40659..40720 + 62 NuclAT_1 - Antitoxin
- (40659) 40659..40720 + 62 NuclAT_1 - Antitoxin
- (40659) 40659..40720 + 62 NuclAT_1 - Antitoxin
- (40659) 40659..40720 + 62 NuclAT_1 - Antitoxin
M5T02_RS23875 (41062) 41062..41274 - 213 WP_001541896.1 ANR family transcriptional regulator -
M5T02_RS23880 (41409) 41409..41969 - 561 WP_000139310.1 fertility inhibition protein FinO -
M5T02_RS23885 (42024) 42024..42767 - 744 WP_039002216.1 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid ant(3'')-Ia / lnu(F) / sul2 / floR / dfrA12 / aadA2 / cmlA1 / tet(M) / aac(3)-IId - 1..120324 120324


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T256494 WP_001312851.1 NZ_CP103746:c40615-40466 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 62 bp

>AT256494 NZ_CP103746:40659-40720 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References