Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 791605..792439 | Replicon | chromosome |
| Accession | NZ_CP103745 | ||
| Organism | Escherichia coli strain 3090 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | B7MK10 |
| Locus tag | M5T02_RS03850 | Protein ID | WP_000854820.1 |
| Coordinates | 791605..791982 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7MK11 |
| Locus tag | M5T02_RS03855 | Protein ID | WP_001285610.1 |
| Coordinates | 792071..792439 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T02_RS03815 (786882) | 786882..787481 | + | 600 | WP_001255034.1 | type II secretion system minor pseudopilin GspJ | - |
| M5T02_RS03820 (787484) | 787484..788461 | + | 978 | WP_000633209.1 | type II secretion system minor pseudopilin GspK | - |
| M5T02_RS03825 (788458) | 788458..789636 | + | 1179 | WP_000094991.1 | type II secretion system protein GspL | - |
| M5T02_RS03830 (789638) | 789638..790174 | + | 537 | WP_000942785.1 | GspM family type II secretion system protein YghD | - |
| M5T02_RS03835 (790541) | 790541..791101 | - | 561 | Protein_752 | DUF4942 domain-containing protein | - |
| M5T02_RS03840 (791186) | 791186..791383 | - | 198 | WP_085949158.1 | DUF957 domain-containing protein | - |
| M5T02_RS03845 (791411) | 791411..791608 | - | 198 | Protein_754 | DUF5983 family protein | - |
| M5T02_RS03850 (791605) | 791605..791982 | - | 378 | WP_000854820.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| M5T02_RS03855 (792071) | 792071..792439 | - | 369 | WP_001285610.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5T02_RS03860 (792519) | 792519..792740 | - | 222 | WP_000692347.1 | DUF987 domain-containing protein | - |
| M5T02_RS03865 (792827) | 792827..793303 | - | 477 | WP_021530763.1 | RadC family protein | - |
| M5T02_RS03870 (793318) | 793318..793797 | - | 480 | WP_000706978.1 | antirestriction protein | - |
| M5T02_RS03875 (794063) | 794063..794881 | - | 819 | WP_001175155.1 | DUF932 domain-containing protein | - |
| M5T02_RS03880 (794971) | 794971..795204 | - | 234 | WP_000883181.1 | DUF905 family protein | - |
| M5T02_RS03885 (795210) | 795210..795887 | - | 678 | WP_001097565.1 | hypothetical protein | - |
| M5T02_RS03890 (796038) | 796038..796718 | - | 681 | WP_001278649.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14043.12 Da Isoelectric Point: 7.8839
>T256475 WP_000854820.1 NZ_CP103745:c791982-791605 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNIILGKHPEVKQ
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNIILGKHPEVKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13606.39 Da Isoelectric Point: 6.0618
>AT256475 WP_001285610.1 NZ_CP103745:c792439-792071 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|