Detailed information of TA system TA256442

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 24415..24744
• Replicon: plasmid pMB2910_1
• Accession: NZ_CP103740
• Organism: Escherichia coli strain 3359

Toxin (Protein)

• Gene name: hok
• Uniprot ID: G9G195
• Locus tag: M5T33_RS24015
• Protein ID: WP_001323520.1
• Coordinates: 24628..24744 (+)
• Length: 39 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	24415..24542 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M5T33_RS23990 (19696)	19696..21654	+	1959	WP_042045562.1	ParB/RepB/Spo0J family partition protein	-
M5T33_RS23995 (21709)	21709..22143	+	435	WP_000845949.1	conjugation system SOS inhibitor PsiB	-
M5T33_RS24000 (22140)	22140..22902	+	763	Protein_26	plasmid SOS inhibition protein A	-
- (22871)	22871..22973	+	103	NuclAT_1	-	-
- (22871)	22871..22973	+	103	NuclAT_1	-	-
- (22871)	22871..22973	+	103	NuclAT_1	-	-
- (22871)	22871..22973	+	103	NuclAT_1	-	-
M5T33_RS24005 (23019)	23019..24388	+	1370	WP_085947770.1	IS3-like element IS150 family transposase	-
- (24415)	24415..24542	+	128	NuclAT_0	-	Antitoxin
- (24415)	24415..24542	+	128	NuclAT_0	-	Antitoxin
- (24415)	24415..24542	+	128	NuclAT_0	-	Antitoxin
- (24415)	24415..24542	+	128	NuclAT_0	-	Antitoxin
M5T33_RS24010 (24528)	24528..24677	+	150	Protein_28	plasmid maintenance protein Mok	-
M5T33_RS24015 (24628)	24628..24744	+	117	WP_001323520.1	type I toxin-antitoxin system Hok family toxin	Toxin
M5T33_RS24020 (24964)	24964..25194	+	231	WP_001426396.1	hypothetical protein	-
M5T33_RS24025 (25192)	25192..25365	-	174	Protein_31	hypothetical protein	-
M5T33_RS24030 (25435)	25435..25641	+	207	WP_000275859.1	hypothetical protein	-
M5T33_RS24035 (25666)	25666..25953	+	288	WP_000107535.1	hypothetical protein	-
M5T33_RS24040 (26072)	26072..26893	+	822	WP_001234469.1	DUF932 domain-containing protein	-
M5T33_RS24045 (27190)	27190..27792	-	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
M5T33_RS24050 (28122)	28122..28505	+	384	WP_001151566.1	conjugal transfer relaxosome DNA-binding protein TraM	-
M5T33_RS24055 (28639)	28639..29316	+	678	WP_001348626.1	PAS domain-containing protein	-
M5T33_RS24060 (29404)	29404..29631	+	228	WP_001254388.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	aac(3)-IIa / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5	senB	1..208091	208091

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (1-34)

Sequences

Toxin

Protein

• Length: 39 a.a.
• Molecular weight: 4455.23 Da
• Isoelectric Point: 8.5110

>T256442 WP_001323520.1 NZ_CP103740:24628-24744 [Escherichia coli]
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 117 bp

Antitoxin

Nucleotide

• Length: 128 bp

>AT256442 NZ_CP103740:24415-24542 [Escherichia coli]
CGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTAA
GTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Toxin

• AlphaFold DB: G9G195

Antitoxin