Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 750694..751529 | Replicon | chromosome |
| Accession | NZ_CP103739 | ||
| Organism | Escherichia coli strain 3359 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | M5T33_RS03665 | Protein ID | WP_000854759.1 |
| Coordinates | 751152..751529 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | M5T33_RS03660 | Protein ID | WP_001295723.1 |
| Coordinates | 750694..751062 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T33_RS03630 (747812) | 747812..748007 | + | 196 | Protein_696 | DUF905 family protein | - |
| M5T33_RS03635 (748125) | 748125..748943 | + | 819 | WP_044810630.1 | DUF932 domain-containing protein | - |
| M5T33_RS03640 (748943) | 748943..749188 | + | 246 | WP_000680586.1 | hypothetical protein | - |
| M5T33_RS03645 (749282) | 749282..749755 | + | 474 | WP_044810631.1 | antirestriction protein | - |
| M5T33_RS03650 (749771) | 749771..750247 | + | 477 | WP_001186775.1 | RadC family protein | - |
| M5T33_RS03655 (750310) | 750310..750531 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| M5T33_RS03660 (750694) | 750694..751062 | + | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5T33_RS03665 (751152) | 751152..751529 | + | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| M5T33_RS03670 (751526) | 751526..752053 | + | 528 | WP_259431154.1 | DUF5983 family protein | - |
| M5T33_RS03680 (753367) | 753367..753543 | + | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| M5T33_RS03685 (753649) | 753649..753798 | + | 150 | Protein_707 | hypothetical protein | - |
| M5T33_RS03690 (754165) | 754165..754341 | + | 177 | Protein_708 | helix-turn-helix domain-containing protein | - |
| M5T33_RS03695 (754605) | 754605..754832 | + | 228 | WP_024183600.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 679611..764444 | 84833 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T256422 WP_000854759.1 NZ_CP103739:751152-751529 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |