Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4192425..4193260 | Replicon | chromosome |
| Accession | NZ_CP103710 | ||
| Organism | Escherichia coli O25b:H4-ST131 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | M5S69_RS20720 | Protein ID | WP_000854759.1 |
| Coordinates | 4192425..4192802 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | M5S69_RS20725 | Protein ID | WP_001295723.1 |
| Coordinates | 4192892..4193260 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S69_RS20690 (4188137) | 4188137..4188883 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| M5S69_RS20695 (4188898) | 4188898..4190439 | - | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| M5S69_RS20700 (4190820) | 4190820..4191125 | - | 306 | Protein_4058 | helix-turn-helix domain-containing protein | - |
| M5S69_RS20705 (4191492) | 4191492..4191641 | - | 150 | Protein_4059 | hypothetical protein | - |
| M5S69_RS20710 (4191747) | 4191747..4191923 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| M5S69_RS20715 (4191940) | 4191940..4192428 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| M5S69_RS20720 (4192425) | 4192425..4192802 | - | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| M5S69_RS20725 (4192892) | 4192892..4193260 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5S69_RS20730 (4193423) | 4193423..4193644 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| M5S69_RS20735 (4193707) | 4193707..4194183 | - | 477 | WP_001186775.1 | RadC family protein | - |
| M5S69_RS20740 (4194199) | 4194199..4194672 | - | 474 | WP_001350782.1 | antirestriction protein | - |
| M5S69_RS20745 (4195014) | 4195014..4195832 | - | 819 | WP_001234738.1 | DUF932 domain-containing protein | - |
| M5S69_RS20750 (4195950) | 4195950..4196145 | - | 196 | Protein_4068 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4178193..4207454 | 29261 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T256290 WP_000854759.1 NZ_CP103710:c4192802-4192425 [Escherichia coli O25b:H4-ST131]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT256290 WP_001295723.1 NZ_CP103710:c4193260-4192892 [Escherichia coli O25b:H4-ST131]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |