Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 57299..57553 | Replicon | plasmid pMB3362_1 |
| Accession | NZ_CP103705 | ||
| Organism | Escherichia coli strain ST361 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | M5T41_RS23605 | Protein ID | WP_001312851.1 |
| Coordinates | 57404..57553 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 57299..57360 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T41_RS23570 (52951) | 52951..53163 | + | 213 | WP_005012601.1 | hypothetical protein | - |
| M5T41_RS23575 (53464) | 53464..53553 | - | 90 | Protein_70 | IS1 family transposase | - |
| M5T41_RS23580 (53608) | 53608..54285 | + | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| M5T41_RS23585 (54285) | 54285..54632 | + | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| M5T41_RS23590 (54652) | 54652..56223 | + | 1572 | WP_023149734.1 | IS66-like element ISCro1 family transposase | - |
| M5T41_RS23595 (56261) | 56261..56877 | - | 617 | Protein_74 | IS1-like element IS1A family transposase | - |
| M5T41_RS23600 (56978) | 56978..57160 | + | 183 | WP_000968309.1 | hypothetical protein | - |
| - (57299) | 57299..57360 | - | 62 | NuclAT_2 | - | Antitoxin |
| - (57299) | 57299..57360 | - | 62 | NuclAT_2 | - | Antitoxin |
| - (57299) | 57299..57360 | - | 62 | NuclAT_2 | - | Antitoxin |
| - (57299) | 57299..57360 | - | 62 | NuclAT_2 | - | Antitoxin |
| M5T41_RS23605 (57404) | 57404..57553 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| M5T41_RS23610 (57837) | 57837..58094 | + | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| M5T41_RS23615 (58330) | 58330..58404 | + | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| M5T41_RS23620 (58397) | 58397..58843 | + | 447 | Protein_79 | plasmid replication initiator RepA | - |
| M5T41_RS23625 (58843) | 58843..59457 | - | 615 | Protein_80 | VENN motif pre-toxin domain-containing protein | - |
| M5T41_RS23630 (60164) | 60164..61384 | + | 1221 | WP_000410951.1 | arginine deiminase | - |
| M5T41_RS23635 (61395) | 61395..62306 | + | 912 | WP_000440183.1 | carbamate kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / aadA5 / qacE / sul1 / mph(A) / tet(B) / sitABCD | iucA / iucB / iucC / iucD / iutA | 1..165827 | 165827 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T256270 WP_001312851.1 NZ_CP103705:57404-57553 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT256270 NZ_CP103705:c57360-57299 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
