Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1805544..1806379 | Replicon | chromosome |
| Accession | NZ_CP103596 | ||
| Organism | Escherichia coli strain 4848 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1X9TM58 |
| Locus tag | M5T19_RS08630 | Protein ID | WP_000854761.1 |
| Coordinates | 1805544..1805921 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | M5T19_RS08635 | Protein ID | WP_001295723.1 |
| Coordinates | 1806011..1806379 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T19_RS08590 (1800933) | 1800933..1801199 | - | 267 | WP_087757644.1 | EutP/PduV family microcompartment system protein | - |
| M5T19_RS08595 (1801569) | 1801569..1801958 | - | 390 | WP_001445118.1 | IS110 family transposase | - |
| M5T19_RS08600 (1802147) | 1802147..1802371 | - | 225 | Protein_1681 | transposase | - |
| M5T19_RS08605 (1802452) | 1802452..1802856 | + | 405 | WP_000839179.1 | transposase | - |
| M5T19_RS08610 (1802853) | 1802853..1803200 | + | 348 | WP_000612626.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| M5T19_RS08615 (1803249) | 1803249..1804788 | + | 1540 | Protein_1684 | IS66-like element ISEc22 family transposase | - |
| M5T19_RS08620 (1805219) | 1805219..1805299 | - | 81 | Protein_1685 | hypothetical protein | - |
| M5T19_RS08625 (1805399) | 1805399..1805547 | - | 149 | Protein_1686 | DUF5983 family protein | - |
| M5T19_RS08630 (1805544) | 1805544..1805921 | - | 378 | WP_000854761.1 | TA system toxin CbtA family protein | Toxin |
| M5T19_RS08635 (1806011) | 1806011..1806379 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5T19_RS08640 (1806542) | 1806542..1806763 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| M5T19_RS08645 (1806826) | 1806826..1807302 | - | 477 | WP_001186774.1 | RadC family protein | - |
| M5T19_RS08650 (1807318) | 1807318..1807791 | - | 474 | WP_000855059.1 | antirestriction protein | - |
| M5T19_RS08655 (1808133) | 1808133..1808951 | - | 819 | WP_046464190.1 | DUF932 domain-containing protein | - |
| M5T19_RS08660 (1809069) | 1809069..1809264 | - | 196 | Protein_1693 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1802452..1855309 | 52857 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14205.25 Da Isoelectric Point: 7.3249
>T255757 WP_000854761.1 NZ_CP103596:c1805921-1805544 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT255757 WP_001295723.1 NZ_CP103596:c1806379-1806011 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1X9TM58 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |