Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1805544..1806379 Replicon chromosome
Accession NZ_CP103596
Organism Escherichia coli strain 4848

Toxin (Protein)


Gene name yeeV Uniprot ID A0A1X9TM58
Locus tag M5T19_RS08630 Protein ID WP_000854761.1
Coordinates 1805544..1805921 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1NM52
Locus tag M5T19_RS08635 Protein ID WP_001295723.1
Coordinates 1806011..1806379 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T19_RS08590 (1800933) 1800933..1801199 - 267 WP_087757644.1 EutP/PduV family microcompartment system protein -
M5T19_RS08595 (1801569) 1801569..1801958 - 390 WP_001445118.1 IS110 family transposase -
M5T19_RS08600 (1802147) 1802147..1802371 - 225 Protein_1681 transposase -
M5T19_RS08605 (1802452) 1802452..1802856 + 405 WP_000839179.1 transposase -
M5T19_RS08610 (1802853) 1802853..1803200 + 348 WP_000612626.1 IS66 family insertion sequence element accessory protein TnpB -
M5T19_RS08615 (1803249) 1803249..1804788 + 1540 Protein_1684 IS66-like element ISEc22 family transposase -
M5T19_RS08620 (1805219) 1805219..1805299 - 81 Protein_1685 hypothetical protein -
M5T19_RS08625 (1805399) 1805399..1805547 - 149 Protein_1686 DUF5983 family protein -
M5T19_RS08630 (1805544) 1805544..1805921 - 378 WP_000854761.1 TA system toxin CbtA family protein Toxin
M5T19_RS08635 (1806011) 1806011..1806379 - 369 WP_001295723.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M5T19_RS08640 (1806542) 1806542..1806763 - 222 WP_000692345.1 DUF987 domain-containing protein -
M5T19_RS08645 (1806826) 1806826..1807302 - 477 WP_001186774.1 RadC family protein -
M5T19_RS08650 (1807318) 1807318..1807791 - 474 WP_000855059.1 antirestriction protein -
M5T19_RS08655 (1808133) 1808133..1808951 - 819 WP_046464190.1 DUF932 domain-containing protein -
M5T19_RS08660 (1809069) 1809069..1809264 - 196 Protein_1693 DUF905 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1802452..1855309 52857


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14205.25 Da        Isoelectric Point: 7.3249

>T255757 WP_000854761.1 NZ_CP103596:c1805921-1805544 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13592.40 Da        Isoelectric Point: 6.6255

>AT255757 WP_001295723.1 NZ_CP103596:c1806379-1806011 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1X9TM58

Antitoxin

Source ID Structure
AlphaFold DB S1NM52

References