Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 57307..57561 | Replicon | plasmid pMB8093_1 |
| Accession | NZ_CP103571 | ||
| Organism | Escherichia coli strain 3045 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | M5S79_RS23255 | Protein ID | WP_001312851.1 |
| Coordinates | 57412..57561 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 57307..57368 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S79_RS23220 (52959) | 52959..53171 | + | 213 | WP_005012601.1 | hypothetical protein | - |
| M5S79_RS23225 (53472) | 53472..53561 | - | 90 | Protein_70 | IS1 family transposase | - |
| M5S79_RS23230 (53616) | 53616..54293 | + | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| M5S79_RS23235 (54293) | 54293..54640 | + | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| M5S79_RS23240 (54660) | 54660..56231 | + | 1572 | WP_023149734.1 | IS66-like element ISCro1 family transposase | - |
| M5S79_RS23245 (56269) | 56269..56885 | - | 617 | Protein_74 | IS1 family transposase | - |
| M5S79_RS23250 (56986) | 56986..57168 | + | 183 | WP_000968309.1 | hypothetical protein | - |
| - (57307) | 57307..57368 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (57307) | 57307..57368 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (57307) | 57307..57368 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (57307) | 57307..57368 | - | 62 | NuclAT_1 | - | Antitoxin |
| M5S79_RS23255 (57412) | 57412..57561 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| M5S79_RS23260 (57845) | 57845..58102 | + | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| M5S79_RS23265 (58338) | 58338..58412 | + | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| M5S79_RS23270 (58405) | 58405..58851 | + | 447 | Protein_79 | plasmid replication initiator RepA | - |
| M5S79_RS23275 (58851) | 58851..59465 | - | 615 | Protein_80 | VENN motif pre-toxin domain-containing protein | - |
| M5S79_RS23280 (60172) | 60172..61392 | + | 1221 | WP_000410951.1 | arginine deiminase | - |
| M5S79_RS23285 (61403) | 61403..62314 | + | 912 | WP_046464193.1 | carbamate kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / aadA5 / qacE / sul1 / mph(A) / tet(B) / sitABCD | iucA / iucB / iucC / iucD / iutA | 1..166880 | 166880 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T255626 WP_001312851.1 NZ_CP103571:57412-57561 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT255626 NZ_CP103571:c57368-57307 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
