Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 5214..5773 Replicon plasmid pMB8236_1
Accession NZ_CP103563
Organism Escherichia coli O25b:H4-ST131 strain 751

Toxin (Protein)


Gene name relE Uniprot ID V0SVC8
Locus tag M5R24_RS25645 Protein ID WP_000421272.1
Coordinates 5214..5489 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0SRR3
Locus tag M5R24_RS25650 Protein ID WP_001387467.1
Coordinates 5489..5773 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5R24_RS25610 (1263) 1263..2003 - 741 WP_001066942.1 tyrosine-type recombinase/integrase -
M5R24_RS25615 (2124) 2124..2306 - 183 WP_042065278.1 hypothetical protein -
M5R24_RS25620 (2373) 2373..2663 - 291 Protein_3 type II toxin-antitoxin system RelE/ParE family toxin -
M5R24_RS25625 (2650) 2650..2918 - 269 Protein_4 type II toxin-antitoxin system ParD family antitoxin -
M5R24_RS25630 (3450) 3450..4619 + 1170 WP_096967623.1 hypothetical protein -
M5R24_RS25635 (4652) 4652..4780 + 129 Protein_6 IS481 family transposase -
M5R24_RS25640 (4905) 4905..5108 - 204 Protein_7 hypothetical protein -
M5R24_RS25645 (5214) 5214..5489 - 276 WP_000421272.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M5R24_RS25650 (5489) 5489..5773 - 285 WP_001387467.1 ribbon-helix-helix domain-containing protein Antitoxin
M5R24_RS25655 (6378) 6378..7130 + 753 WP_001403368.1 IclR family transcriptional regulator -
M5R24_RS25660 (7176) 7176..8141 - 966 WP_001022265.1 2-keto-3-deoxygluconate transporter -
M5R24_RS25665 (8174) 8174..8554 - 381 WP_000710783.1 Rid family detoxifying hydrolase -
M5R24_RS25670 (8579) 8579..9469 - 891 WP_096967625.1 dihydrodipicolinate synthase family protein -
M5R24_RS25675 (9702) 9702..9896 - 195 WP_000796505.1 hypothetical protein -
M5R24_RS25680 (9870) 9870..10310 + 441 Protein_15 zinc-binding dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aac(3)-IIa / blaCTX-M-15 / aac(6')-Ib-cr / blaOXA-1 / tet(A) / blaTEM-1B / mph(A) / sul1 / qacE / aadA2 / dfrA12 / sul2 senB / hlyD / hlyB / hlyA / hlyA / hlyC 1..241084 241084


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 10.0871

>T255579 WP_000421272.1 NZ_CP103563:c5489-5214 [Escherichia coli O25b:H4-ST131]
MELKWTSKALSDLSRLFDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYEINGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10460.87 Da        Isoelectric Point: 5.6558

>AT255579 WP_001387467.1 NZ_CP103563:c5773-5489 [Escherichia coli O25b:H4-ST131]
MQMKNNAAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
SDSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0SVC8

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0Y880

References