Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4669643..4670444 Replicon chromosome
Accession NZ_CP103562
Organism Escherichia coli O25b:H4-ST131 strain 751

Toxin (Protein)


Gene name yeeV Uniprot ID D8EBK0
Locus tag M5R24_RS23130 Protein ID WP_001094436.1
Coordinates 4670067..4670444 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MN76
Locus tag M5R24_RS23125 Protein ID WP_015953067.1
Coordinates 4669643..4670020 (+) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5R24_RS23090 (4665555) 4665555..4666235 + 681 WP_001282927.1 WYL domain-containing protein -
M5R24_RS23095 (4666383) 4666383..4667060 + 678 WP_001097312.1 hypothetical protein -
M5R24_RS23100 (4667066) 4667066..4667299 + 234 WP_001278287.1 DUF905 family protein -
M5R24_RS23105 (4667389) 4667389..4668207 + 819 WP_001175142.1 DUF932 domain-containing protein -
M5R24_RS23110 (4668298) 4668298..4668783 + 486 WP_000860054.1 antirestriction protein -
M5R24_RS23115 (4668798) 4668798..4669274 + 477 WP_001186756.1 RadC family protein -
M5R24_RS23120 (4669343) 4669343..4669564 + 222 WP_000692312.1 DUF987 domain-containing protein -
M5R24_RS23125 (4669643) 4669643..4670020 + 378 WP_015953067.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
M5R24_RS23130 (4670067) 4670067..4670444 + 378 WP_001094436.1 TA system toxin CbtA family protein Toxin
M5R24_RS23135 (4670441) 4670441..4670929 + 489 WP_000761714.1 DUF5983 family protein -
M5R24_RS23140 (4670941) 4670941..4671138 + 198 WP_000839254.1 DUF957 domain-containing protein -
M5R24_RS23145 (4671223) 4671223..4671933 + 711 WP_001621817.1 DUF4942 domain-containing protein -
M5R24_RS23150 (4671982) 4671982..4672737 - 756 WP_000065240.1 IS21-like element ISEc10 family helper ATPase IstB -
M5R24_RS23155 (4672734) 4672734..4674233 - 1500 WP_029700729.1 IS21-like element ISEc10 family transposase -
M5R24_RS23160 (4674324) 4674324..4674485 + 162 Protein_4547 DUF4942 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13958.84 Da        Isoelectric Point: 6.8603

>T255576 WP_001094436.1 NZ_CP103562:4670067-4670444 [Escherichia coli O25b:H4-ST131]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13766.60 Da        Isoelectric Point: 6.2021

>AT255576 WP_015953067.1 NZ_CP103562:4669643-4670020 [Escherichia coli O25b:H4-ST131]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E2L1N0

Antitoxin

Source ID Structure
AlphaFold DB A0A5Z3CIS0

References