Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4395707..4396542 | Replicon | chromosome |
| Accession | NZ_CP103562 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 751 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | M5R24_RS21710 | Protein ID | WP_000854759.1 |
| Coordinates | 4396165..4396542 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | M5R24_RS21705 | Protein ID | WP_001295723.1 |
| Coordinates | 4395707..4396075 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R24_RS21680 (4392822) | 4392822..4393017 | + | 196 | Protein_4256 | DUF905 family protein | - |
| M5R24_RS21685 (4393135) | 4393135..4393953 | + | 819 | WP_001234738.1 | DUF932 domain-containing protein | - |
| M5R24_RS21690 (4394295) | 4394295..4394768 | + | 474 | WP_001350782.1 | antirestriction protein | - |
| M5R24_RS21695 (4394784) | 4394784..4395260 | + | 477 | WP_001186775.1 | RadC family protein | - |
| M5R24_RS21700 (4395323) | 4395323..4395544 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| M5R24_RS21705 (4395707) | 4395707..4396075 | + | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5R24_RS21710 (4396165) | 4396165..4396542 | + | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| M5R24_RS21715 (4396539) | 4396539..4397027 | + | 489 | WP_000761690.1 | DUF5983 family protein | - |
| M5R24_RS21720 (4397044) | 4397044..4397220 | + | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| M5R24_RS21725 (4397326) | 4397326..4397475 | + | 150 | Protein_4265 | hypothetical protein | - |
| M5R24_RS21730 (4397934) | 4397934..4399475 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| M5R24_RS21735 (4399490) | 4399490..4400236 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| M5R24_RS21740 (4400428) | 4400428..4400604 | + | 177 | Protein_4268 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4382012..4410774 | 28762 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T255574 WP_000854759.1 NZ_CP103562:4396165-4396542 [Escherichia coli O25b:H4-ST131]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT255574 WP_001295723.1 NZ_CP103562:4395707-4396075 [Escherichia coli O25b:H4-ST131]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |