Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 849884..850718 | Replicon | chromosome |
| Accession | NZ_CP103562 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 751 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PLF5 |
| Locus tag | M5R24_RS04165 | Protein ID | WP_000854690.1 |
| Coordinates | 849884..850261 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1P7N8 |
| Locus tag | M5R24_RS04170 | Protein ID | WP_001305076.1 |
| Coordinates | 850350..850718 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R24_RS04135 (846278) | 846278..846448 | - | 171 | Protein_813 | IS110 family transposase | - |
| M5R24_RS04140 (846865) | 846865..847798 | - | 934 | Protein_814 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| M5R24_RS04145 (847791) | 847791..848186 | - | 396 | WP_000208384.1 | DUF6088 family protein | - |
| M5R24_RS04150 (848255) | 848255..849100 | - | 846 | WP_001529401.1 | DUF4942 domain-containing protein | - |
| M5R24_RS04155 (849185) | 849185..849382 | - | 198 | WP_000839293.1 | DUF957 domain-containing protein | - |
| M5R24_RS04160 (849399) | 849399..849887 | - | 489 | WP_000761699.1 | DUF5983 family protein | - |
| M5R24_RS04165 (849884) | 849884..850261 | - | 378 | WP_000854690.1 | TA system toxin CbtA family protein | Toxin |
| M5R24_RS04170 (850350) | 850350..850718 | - | 369 | WP_001305076.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5R24_RS04175 (850768) | 850768..851412 | - | 645 | WP_000094916.1 | hypothetical protein | - |
| M5R24_RS04180 (851431) | 851431..851652 | - | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| M5R24_RS04185 (851715) | 851715..852191 | - | 477 | WP_001186726.1 | RadC family protein | - |
| M5R24_RS04190 (852207) | 852207..852692 | - | 486 | WP_000849565.1 | antirestriction protein | - |
| M5R24_RS04195 (852747) | 852747..853565 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| M5R24_RS04200 (853666) | 853666..853899 | - | 234 | WP_000902034.1 | DUF905 family protein | - |
| M5R24_RS04205 (853978) | 853978..854433 | - | 456 | WP_000581502.1 | IrmA family protein | - |
| M5R24_RS04210 (854509) | 854509..855636 | - | 1128 | Protein_828 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 846278..846433 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14057.04 Da Isoelectric Point: 9.1510
>T255560 WP_000854690.1 NZ_CP103562:c850261-849884 [Escherichia coli O25b:H4-ST131]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13560.39 Da Isoelectric Point: 4.7830
>AT255560 WP_001305076.1 NZ_CP103562:c850718-850350 [Escherichia coli O25b:H4-ST131]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|