Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 45968..46800 | Replicon | chromosome |
| Accession | NZ_CP103562 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 751 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | E3PN67 |
| Locus tag | M5R24_RS00245 | Protein ID | WP_000854775.1 |
| Coordinates | 45968..46342 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A426P7N5 |
| Locus tag | M5R24_RS00250 | Protein ID | WP_001285645.1 |
| Coordinates | 46432..46800 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R24_RS00215 (41328) | 41328..42146 | + | 819 | WP_000779409.1 | lipoprotein NlpA | - |
| M5R24_RS00220 (42150) | 42150..43073 | - | 924 | WP_000535950.1 | carboxylate/amino acid/amine transporter | - |
| M5R24_RS00225 (43251) | 43251..43748 | - | 498 | WP_000509815.1 | hypothetical protein | - |
| M5R24_RS00230 (44344) | 44344..45186 | - | 843 | WP_001274548.1 | DUF4942 domain-containing protein | - |
| M5R24_RS00235 (45271) | 45271..45468 | - | 198 | WP_000772035.1 | DUF957 domain-containing protein | - |
| M5R24_RS00240 (45480) | 45480..45971 | - | 492 | WP_000976825.1 | DUF5983 family protein | - |
| M5R24_RS00245 (45968) | 45968..46342 | - | 375 | WP_000854775.1 | TA system toxin CbtA family protein | Toxin |
| M5R24_RS00250 (46432) | 46432..46800 | - | 369 | WP_001285645.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5R24_RS00255 (46963) | 46963..47184 | - | 222 | WP_000692303.1 | DUF987 domain-containing protein | - |
| M5R24_RS00260 (47253) | 47253..47729 | - | 477 | WP_001186201.1 | RadC family protein | - |
| M5R24_RS00265 (47745) | 47745..48230 | - | 486 | WP_000213721.1 | antirestriction protein | - |
| M5R24_RS00270 (48322) | 48322..49140 | - | 819 | WP_063611089.1 | DUF932 domain-containing protein | - |
| M5R24_RS00275 (49230) | 49230..49463 | - | 234 | WP_001278284.1 | DUF905 family protein | - |
| M5R24_RS00280 (49469) | 49469..50146 | - | 678 | WP_001097567.1 | hypothetical protein | - |
| M5R24_RS00285 (50297) | 50297..50977 | - | 681 | WP_063611088.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13965.02 Da Isoelectric Point: 8.2830
>T255556 WP_000854775.1 NZ_CP103562:c46342-45968 [Escherichia coli O25b:H4-ST131]
MKTLPDTLVREASRCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAK
MKTLPDTLVREASRCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13678.37 Da Isoelectric Point: 5.4492
>AT255556 WP_001285645.1 NZ_CP103562:c46800-46432 [Escherichia coli O25b:H4-ST131]
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRADIRGRFSDADAYHLDQAFPLLMKQLELMLTNG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRADIRGRFSDADAYHLDQAFPLLMKQLELMLTNG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | E3PN67 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A426P7N5 |