Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3445872..3446670 Replicon chromosome
Accession NZ_CP103559
Organism Escherichia coli strain 3059

Toxin (Protein)


Gene name yeeV Uniprot ID A0A3L4GA68
Locus tag M5T18_RS17050 Protein ID WP_000854898.1
Coordinates 3445872..3446249 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A3L4GA79
Locus tag M5T18_RS17055 Protein ID WP_001390639.1
Coordinates 3446296..3446670 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T18_RS17020 (3442541) 3442541..3443245 + 705 WP_001241678.1 leucyl/phenylalanyl-tRNA--protein transferase -
M5T18_RS17025 (3443530) 3443530..3443748 + 219 WP_001040187.1 translation initiation factor IF-1 -
M5T18_RS17035 (3444239) 3444239..3445081 - 843 WP_000014507.1 DUF4942 domain-containing protein -
M5T18_RS17040 (3445178) 3445178..3445375 - 198 WP_000839285.1 DUF957 domain-containing protein -
M5T18_RS17045 (3445387) 3445387..3445875 - 489 WP_000761668.1 DUF5983 family protein -
M5T18_RS17050 (3445872) 3445872..3446249 - 378 WP_000854898.1 TA system toxin CbtA family protein Toxin
M5T18_RS17055 (3446296) 3446296..3446670 - 375 WP_001390639.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
M5T18_RS17060 (3446750) 3446750..3446971 - 222 WP_000692352.1 DUF987 domain-containing protein -
M5T18_RS17065 (3447058) 3447058..3447534 - 477 WP_001186776.1 RadC family protein -
M5T18_RS17070 (3447550) 3447550..3448035 - 486 WP_000213691.1 antirestriction protein -
M5T18_RS17075 (3448127) 3448127..3448945 - 819 WP_001234635.1 DUF932 domain-containing protein -
M5T18_RS17080 (3449039) 3449039..3449217 + 179 Protein_3347 hypothetical protein -
M5T18_RS17085 (3449356) 3449356..3449769 - 414 WP_000789536.1 hypothetical protein -
M5T18_RS17090 (3450039) 3450039..3450578 - 540 WP_001104026.1 DUF4339 domain-containing protein -
M5T18_RS17095 (3450704) 3450704..3451162 - 459 WP_000771527.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14050.07 Da        Isoelectric Point: 8.5190

>T255531 WP_000854898.1 NZ_CP103559:c3446249-3445872 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWKTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITLGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13566.36 Da        Isoelectric Point: 6.0568

>AT255531 WP_001390639.1 NZ_CP103559:c3446670-3446296 [Escherichia coli]
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTGG
ELNPRHQHTATLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3L4GA68

Antitoxin

Source ID Structure
AlphaFold DB A0A3L4GA79

References