Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3195540..3196384 Replicon chromosome
Accession NZ_CP103559
Organism Escherichia coli strain 3059

Toxin (Protein)


Gene name yeeV Uniprot ID B1LJY4
Locus tag M5T18_RS15905 Protein ID WP_000854686.1
Coordinates 3195540..3195923 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A8E0J1S3
Locus tag M5T18_RS15910 Protein ID WP_001285602.1
Coordinates 3196004..3196384 (-) Length 127 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T18_RS15865 (3190542) 3190542..3191033 - 492 WP_032145787.1 DUF1097 domain-containing protein -
M5T18_RS15870 (3191135) 3191135..3191689 - 555 WP_001001909.1 molecular chaperone YcdY -
M5T18_RS15875 (3191713) 3191713..3192450 - 738 WP_000283664.1 zinc-binding phosphatase -
M5T18_RS15880 (3192505) 3192505..3193443 - 939 WP_001550942.1 glyoxylate/hydroxypyruvate reductase GhrA -
M5T18_RS15890 (3193914) 3193914..3194756 - 843 WP_001431817.1 DUF4942 domain-containing protein -
M5T18_RS15895 (3194841) 3194841..3195038 - 198 WP_000839253.1 DUF957 domain-containing protein -
M5T18_RS15900 (3195055) 3195055..3195543 - 489 WP_001054233.1 DUF5983 family protein -
M5T18_RS15905 (3195540) 3195540..3195923 - 384 WP_000854686.1 TA system toxin CbtA family protein Toxin
M5T18_RS15910 (3196004) 3196004..3196384 - 381 WP_001285602.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M5T18_RS15915 (3196395) 3196395..3197078 - 684 WP_000086768.1 hypothetical protein -
M5T18_RS15920 (3197097) 3197097..3197318 - 222 WP_000692298.1 DUF987 domain-containing protein -
M5T18_RS15925 (3197381) 3197381..3197857 - 477 WP_001186726.1 RadC family protein -
M5T18_RS15930 (3197873) 3197873..3198358 - 486 WP_000214307.1 antirestriction protein -
M5T18_RS15935 (3198450) 3198450..3199268 - 819 WP_001234732.1 DUF932 domain-containing protein -
M5T18_RS15940 (3199368) 3199368..3199601 - 234 WP_001119719.1 DUF905 family protein -
M5T18_RS15945 (3199680) 3199680..3200135 - 456 WP_001504120.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - csgA / csgB / csgD / csgE / csgF / csgG 3186427..3218660 32233


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-113)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 14272.28 Da        Isoelectric Point: 6.8614

>T255530 WP_000854686.1 NZ_CP103559:c3195923-3195540 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ

Download         Length: 384 bp

Antitoxin


Download         Length: 127 a.a.        Molecular weight: 13938.69 Da        Isoelectric Point: 5.0823

>AT255530 WP_001285602.1 NZ_CP103559:c3196384-3196004 [Escherichia coli]
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE

Download         Length: 381 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References