Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1905289..1906121 Replicon chromosome
Accession NZ_CP103559
Organism Escherichia coli strain 3059

Toxin (Protein)


Gene name yeeV Uniprot ID A0A1L4HFA4
Locus tag M5T18_RS09010 Protein ID WP_032163901.1
Coordinates 1905289..1905663 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1NM52
Locus tag M5T18_RS09015 Protein ID WP_001295723.1
Coordinates 1905753..1906121 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T18_RS08970 (1900685) 1900685..1901851 + 1167 WP_042031746.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
M5T18_RS08975 (1901970) 1901970..1902443 + 474 WP_001105415.1 DNA gyrase inhibitor SbmC -
M5T18_RS08980 (1902641) 1902641..1903699 + 1059 WP_001200891.1 FUSC family protein -
M5T18_RS08985 (1903871) 1903871..1904200 + 330 WP_000450409.1 DUF496 family protein -
M5T18_RS08990 (1904301) 1904301..1904435 - 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
M5T18_RS08995 (1904555) 1904555..1904683 + 129 Protein_1758 transposase domain-containing protein -
M5T18_RS09000 (1904972) 1904972..1905052 - 81 Protein_1759 hypothetical protein -
M5T18_RS09005 (1905098) 1905098..1905292 - 195 WP_000988600.1 DUF5983 family protein -
M5T18_RS09010 (1905289) 1905289..1905663 - 375 WP_032163901.1 TA system toxin CbtA family protein Toxin
M5T18_RS09015 (1905753) 1905753..1906121 - 369 WP_001295723.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M5T18_RS09020 (1906284) 1906284..1906505 - 222 WP_000692345.1 DUF987 domain-containing protein -
M5T18_RS09025 (1906568) 1906568..1907044 - 477 WP_001186710.1 RadC family protein -
M5T18_RS09030 (1907056) 1907056..1907535 - 480 WP_000860065.1 antirestriction protein -
M5T18_RS09035 (1907617) 1907617..1908435 - 819 WP_001234631.1 DUF932 domain-containing protein -
M5T18_RS09040 (1908535) 1908535..1908768 - 234 WP_001119724.1 DUF905 family protein -
M5T18_RS09045 (1908847) 1908847..1909302 - 456 WP_000581504.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13919.89 Da        Isoelectric Point: 7.7760

>T255516 WP_032163901.1 NZ_CP103559:c1905663-1905289 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13592.40 Da        Isoelectric Point: 6.6255

>AT255516 WP_001295723.1 NZ_CP103559:c1906121-1905753 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1L4HFA4

Antitoxin

Source ID Structure
AlphaFold DB S1NM52

References