Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 834501..835333 Replicon chromosome
Accession NZ_CP103529
Organism Escherichia coli strain 5270

Toxin (Protein)


Gene name yeeV Uniprot ID A7ZVJ9
Locus tag M5T24_RS04055 Protein ID WP_000854765.1
Coordinates 834501..834875 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1NM52
Locus tag M5T24_RS04060 Protein ID WP_001295723.1
Coordinates 834965..835333 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T24_RS04020 (829579) 829579..830178 + 600 WP_001255034.1 type II secretion system minor pseudopilin GspJ -
M5T24_RS04025 (830181) 830181..831158 + 978 WP_000633209.1 type II secretion system minor pseudopilin GspK -
M5T24_RS04030 (831155) 831155..832333 + 1179 WP_000094991.1 type II secretion system protein GspL -
M5T24_RS04035 (832335) 832335..832871 + 537 WP_000942785.1 GspM family type II secretion system protein YghD -
M5T24_RS04040 (833152) 833152..833994 - 843 WP_022645115.1 DUF4942 domain-containing protein -
M5T24_RS04045 (834079) 834079..834273 - 195 WP_024181941.1 DUF957 domain-containing protein -
M5T24_RS04050 (834298) 834298..834501 - 204 WP_001398797.1 DUF5983 family protein -
M5T24_RS04055 (834501) 834501..834875 - 375 WP_000854765.1 TA system toxin CbtA family protein Toxin
M5T24_RS04060 (834965) 834965..835333 - 369 WP_001295723.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M5T24_RS04065 (835496) 835496..835717 - 222 WP_000692341.1 DUF987 domain-containing protein -
M5T24_RS04070 (835780) 835780..836256 - 477 WP_001186774.1 RadC family protein -
M5T24_RS04075 (836272) 836272..836751 - 480 WP_057109541.1 antirestriction protein -
M5T24_RS04080 (837017) 837017..837835 - 819 WP_001175165.1 DUF932 domain-containing protein -
M5T24_RS04085 (837925) 837925..838158 - 234 WP_001278293.1 DUF905 family protein -
M5T24_RS04090 (838164) 838164..838841 - 678 WP_001097302.1 hypothetical protein -
M5T24_RS04095 (838989) 838989..839669 - 681 WP_001282921.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13970.98 Da        Isoelectric Point: 7.2909

>T255329 WP_000854765.1 NZ_CP103529:c834875-834501 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13592.40 Da        Isoelectric Point: 6.6255

>AT255329 WP_001295723.1 NZ_CP103529:c835333-834965 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A7ZVJ9

Antitoxin

Source ID Structure
AlphaFold DB S1NM52

References