Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 824162..824997 | Replicon | chromosome |
| Accession | NZ_CP103521 | ||
| Organism | Escherichia coli strain 2779 - blood draw same patient as MB9267 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | M5S63_RS03930 | Protein ID | WP_021543420.1 |
| Coordinates | 824162..824539 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | Q5I3J0 |
| Locus tag | M5S63_RS03935 | Protein ID | WP_001280951.1 |
| Coordinates | 824629..824997 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S63_RS03900 (819289) | 819289..820437 | - | 1149 | WP_000905922.1 | capsule polysaccharide export inner-membrane protein KpsE | - |
| M5S63_RS03905 (820509) | 820509..821492 | - | 984 | WP_001298261.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| M5S63_RS03910 (822303) | 822303..822473 | - | 171 | Protein_767 | IS110 family transposase | - |
| M5S63_RS03915 (822816) | 822816..823658 | - | 843 | WP_001290171.1 | DUF4942 domain-containing protein | - |
| M5S63_RS03920 (823743) | 823743..823940 | - | 198 | WP_086795284.1 | DUF957 domain-containing protein | - |
| M5S63_RS03925 (824016) | 824016..824165 | - | 150 | Protein_770 | DUF5983 family protein | - |
| M5S63_RS03930 (824162) | 824162..824539 | - | 378 | WP_021543420.1 | TA system toxin CbtA family protein | Toxin |
| M5S63_RS03935 (824629) | 824629..824997 | - | 369 | WP_001280951.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5S63_RS03940 (825160) | 825160..825381 | - | 222 | WP_001405861.1 | DUF987 domain-containing protein | - |
| M5S63_RS03945 (825450) | 825450..825926 | - | 477 | WP_001186724.1 | RadC family protein | - |
| M5S63_RS03950 (825942) | 825942..826427 | - | 486 | WP_000213717.1 | antirestriction protein | - |
| M5S63_RS03955 (826504) | 826504..827322 | - | 819 | WP_001175170.1 | DUF932 domain-containing protein | - |
| M5S63_RS03960 (827412) | 827412..827645 | - | 234 | WP_001278288.1 | DUF905 family protein | - |
| M5S63_RS03965 (827651) | 827651..828328 | - | 678 | WP_001097362.1 | hypothetical protein | - |
| M5S63_RS03970 (828447) | 828447..829331 | - | 885 | WP_000010399.1 | 50S ribosome-binding GTPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13975.96 Da Isoelectric Point: 8.2905
>T255291 WP_021543420.1 NZ_CP103521:c824539-824162 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13699.56 Da Isoelectric Point: 7.0268
>AT255291 WP_001280951.1 NZ_CP103521:c824997-824629 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|