Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 48682..48921 | Replicon | plasmid pMB9366_1 |
| Accession | NZ_CP103509 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 5506 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | M5T03_RS24790 | Protein ID | WP_023144756.1 |
| Coordinates | 48682..48816 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 48861..48921 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T03_RS24755 (44693) | 44693..45094 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| M5T03_RS24760 (45027) | 45027..45284 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| M5T03_RS24765 (45377) | 45377..46030 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| M5T03_RS24770 (46970) | 46970..47827 | - | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
| M5T03_RS24775 (47820) | 47820..47894 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| M5T03_RS24780 (47894) | 47894..48025 | - | 132 | Protein_54 | protein CopA/IncA | - |
| M5T03_RS24785 (48131) | 48131..48385 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| M5T03_RS24790 (48682) | 48682..48816 | - | 135 | WP_023144756.1 | Hok/Gef family protein | Toxin |
| - (48861) | 48861..48921 | + | 61 | NuclAT_2 | - | Antitoxin |
| - (48861) | 48861..48921 | + | 61 | NuclAT_2 | - | Antitoxin |
| - (48861) | 48861..48921 | + | 61 | NuclAT_2 | - | Antitoxin |
| - (48861) | 48861..48921 | + | 61 | NuclAT_2 | - | Antitoxin |
| M5T03_RS24795 (48888) | 48888..49174 | - | 287 | Protein_57 | DUF2726 domain-containing protein | - |
| M5T03_RS24800 (49252) | 49252..50865 | - | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| M5T03_RS24805 (50896) | 50896..51246 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| M5T03_RS24810 (51243) | 51243..51668 | - | 426 | WP_000422741.1 | transposase | - |
| M5T03_RS24815 (52227) | 52227..52439 | - | 213 | WP_013023861.1 | hypothetical protein | - |
| M5T03_RS24820 (52570) | 52570..53130 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-52B | senB | 1..111292 | 111292 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T255236 WP_023144756.1 NZ_CP103509:c48816-48682 [Escherichia coli O25b:H4-ST131]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 61 bp
>AT255236 NZ_CP103509:48861-48921 [Escherichia coli O25b:H4-ST131]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
