Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 55870..56124 | Replicon | plasmid pMB9635_1 |
| Accession | NZ_CP103480 | ||
| Organism | Escherichia coli strain 4621 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | M5T46_RS24935 | Protein ID | WP_001312851.1 |
| Coordinates | 55975..56124 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 55870..55931 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T46_RS24900 (51522) | 51522..51734 | + | 213 | WP_005012601.1 | hypothetical protein | - |
| M5T46_RS24905 (52035) | 52035..52124 | - | 90 | Protein_69 | IS1 family transposase | - |
| M5T46_RS24910 (52179) | 52179..52856 | + | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| M5T46_RS24915 (52856) | 52856..53203 | + | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| M5T46_RS24920 (53223) | 53223..54794 | + | 1572 | WP_023149734.1 | IS66-like element ISCro1 family transposase | - |
| M5T46_RS24925 (54832) | 54832..55448 | - | 617 | Protein_73 | IS1 family transposase | - |
| M5T46_RS24930 (55549) | 55549..55731 | + | 183 | WP_000968309.1 | hypothetical protein | - |
| - (55870) | 55870..55931 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (55870) | 55870..55931 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (55870) | 55870..55931 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (55870) | 55870..55931 | - | 62 | NuclAT_1 | - | Antitoxin |
| M5T46_RS24935 (55975) | 55975..56124 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| M5T46_RS24940 (56408) | 56408..56665 | + | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| M5T46_RS24945 (56901) | 56901..56975 | + | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| M5T46_RS24950 (56968) | 56968..57414 | + | 447 | Protein_78 | plasmid replication initiator RepA | - |
| M5T46_RS24955 (57414) | 57414..58028 | - | 615 | Protein_79 | VENN motif pre-toxin domain-containing protein | - |
| M5T46_RS24960 (58735) | 58735..59955 | + | 1221 | WP_000410951.1 | arginine deiminase | - |
| M5T46_RS24965 (59966) | 59966..60877 | + | 912 | WP_000440183.1 | carbamate kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | erm(B) / blaCTX-M-27 / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / sitABCD | - | 1..143132 | 143132 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T255150 WP_001312851.1 NZ_CP103480:55975-56124 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT255150 NZ_CP103480:c55931-55870 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
