Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4335346..4335604 | Replicon | chromosome |
Accession | NZ_CP103479 | ||
Organism | Escherichia coli strain 4621 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | M5T46_RS20610 | Protein ID | WP_000809168.1 |
Coordinates | 4335452..4335604 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 4335346..4335403 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T46_RS20595 | 4331738..4332697 | + | 960 | WP_000871677.1 | hypothetical protein | - |
M5T46_RS20600 | 4332735..4333634 | - | 900 | WP_001300855.1 | transcriptional activator NhaR | - |
M5T46_RS20605 | 4333700..4334866 | - | 1167 | WP_000681352.1 | Na+/H+ antiporter NhaA | - |
- | 4335346..4335403 | - | 58 | - | - | Antitoxin |
M5T46_RS20610 | 4335452..4335604 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
M5T46_RS20615 | 4335708..4336838 | - | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
M5T46_RS20620 | 4336927..4338843 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
M5T46_RS20625 | 4339219..4339623 | + | 405 | WP_000843582.1 | DUF2541 family protein | - |
M5T46_RS20630 | 4339649..4340362 | + | 714 | WP_001102367.1 | acidic protein MsyB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T255141 WP_000809168.1 NZ_CP103479:4335452-4335604 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT255141 NZ_CP103479:c4335403-4335346 [Escherichia coli]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|