Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1944283..1945114 Replicon chromosome
Accession NZ_CP103465
Organism Escherichia coli O25b:H4-ST131 strain 5392

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag M5T42_RS09230 Protein ID WP_000854814.1
Coordinates 1944283..1944657 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A641DSP2
Locus tag M5T42_RS09235 Protein ID WP_001546021.1
Coordinates 1944746..1945114 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T42_RS09195 (1940278) 1940278..1940607 + 330 WP_000450409.1 DUF496 family protein -
M5T42_RS09200 (1940708) 1940708..1941031 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
M5T42_RS09205 (1941010) 1941010..1941090 + 81 WP_023441679.1 hypothetical protein -
M5T42_RS09210 (1941301) 1941301..1942842 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
M5T42_RS09215 (1942857) 1942857..1943603 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
M5T42_RS09220 (1943966) 1943966..1944046 - 81 Protein_1806 hypothetical protein -
M5T42_RS09225 (1944092) 1944092..1944286 - 195 WP_000988601.1 DUF5983 family protein -
M5T42_RS09230 (1944283) 1944283..1944657 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
M5T42_RS09235 (1944746) 1944746..1945114 - 369 WP_001546021.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
M5T42_RS09240 (1945194) 1945194..1945415 - 222 WP_000692323.1 DUF987 domain-containing protein -
M5T42_RS09245 (1945478) 1945478..1945954 - 477 WP_001186773.1 RadC family protein -
M5T42_RS09250 (1945970) 1945970..1946443 - 474 WP_001385393.1 antirestriction protein -
M5T42_RS09255 (1946706) 1946706..1947527 - 822 WP_001234710.1 DUF932 domain-containing protein -
M5T42_RS09260 (1947748) 1947748..1948158 - 411 WP_000846704.1 hypothetical protein -
M5T42_RS09265 (1948174) 1948174..1948851 - 678 WP_001362823.1 hypothetical protein -
M5T42_RS09270 (1948987) 1948987..1950057 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T255078 WP_000854814.1 NZ_CP103465:c1944657-1944283 [Escherichia coli O25b:H4-ST131]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13607.47 Da        Isoelectric Point: 6.3139

>AT255078 WP_001546021.1 NZ_CP103465:c1945114-1944746 [Escherichia coli O25b:H4-ST131]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A641DSP2

References